Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yfjZ-ypjF/CbtA-CbeA
Location 86436..87192 Replicon chromosome
Accession NZ_LR134373
Organism Yersinia pseudotuberculosis strain NCTC10275

Toxin (Protein)


Gene name ypjF Uniprot ID A0A3G5KDU1
Locus tag EL213_RS00405 Protein ID WP_032467110.1
Coordinates 86824..87192 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID Q664A5
Locus tag EL213_RS00400 Protein ID WP_011193303.1
Coordinates 86436..86771 (+) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL213_RS00370 82054..82674 - 621 WP_011193309.1 inovirus Gp2 family protein -
EL213_RS00375 83339..83632 + 294 Protein_68 ATP-binding protein -
EL213_RS00380 83686..84312 + 627 WP_024063555.1 hypothetical protein -
EL213_RS00385 84560..85114 + 555 WP_011193306.1 hypothetical protein -
EL213_RS00390 85142..85762 + 621 WP_011193305.1 hypothetical protein -
EL213_RS00395 85945..86424 + 480 WP_011193304.1 hypothetical protein -
EL213_RS00400 86436..86771 + 336 WP_011193303.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
EL213_RS00405 86824..87192 + 369 WP_032467110.1 TA system toxin CbtA family protein Toxin
EL213_RS00410 87419..88273 + 855 WP_032467109.1 DUF4942 domain-containing protein -
EL213_RS00415 88648..88920 + 273 WP_024063554.1 Arm DNA-binding domain-containing protein -
EL213_RS00420 89155..89562 + 408 WP_024063553.1 hypothetical protein -
EL213_RS00425 89585..89911 + 327 WP_011193298.1 hypothetical protein -
EL213_RS00430 89853..90353 + 501 WP_002214364.1 virulence RhuM family protein -
EL213_RS00435 90350..91108 - 759 WP_011193297.1 ABC transporter ATP-binding protein -
EL213_RS00440 91105..92112 - 1008 WP_011193296.1 iron chelate uptake ABC transporter family permease subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 83348..83632 284


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-111)

Antitoxin

Antitoxin CbeA

(7-106)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13723.81 Da        Isoelectric Point: 6.4530

>T287820 WP_032467110.1 NZ_LR134373:86824-87192 [Yersinia pseudotuberculosis]
MQILPVTPKRAAYACPSPVVVWQSMLTYLLEQHYGLALNDTEFSDDAVIHEYIDAGISLSDALNFTVEKFGLVRIDRRGF
SCQEQSPFITAIDILRARRATGLMTRLGYQTIISVIRGEKQT

Download         Length: 369 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12452.06 Da        Isoelectric Point: 6.0555

>AT287820 WP_011193303.1 NZ_LR134373:86436-86771 [Yersinia pseudotuberculosis]
MPSITTPAWGLKRNVTPQFGARLVQEGDRLHFLADRADINGTFSEVQVRDLDNAFPQFINYLELMLLSGELNPRHQHCVT
LYRNGLTCEADSLGSHGYVYLAIYPTPQSTA

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G5KDU1

Antitoxin

Source ID Structure
AlphaFold DB Q664A5

References