Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 243497..244131 | Replicon | chromosome |
Accession | NZ_LR134365 | ||
Organism | Cardiobacterium hominis strain NCTC10426 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EL199_RS01080 | Protein ID | WP_004141166.1 |
Coordinates | 243497..243898 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | C8N9V4 |
Locus tag | EL199_RS01085 | Protein ID | WP_004141165.1 |
Coordinates | 243898..244131 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL199_RS01055 | 239040..239936 | - | 897 | WP_126315949.1 | tetratricopeptide repeat protein | - |
EL199_RS01060 | 239983..240777 | - | 795 | WP_004141170.1 | ABC transporter permease | - |
EL199_RS01065 | 240774..241538 | - | 765 | WP_004141169.1 | ABC transporter ATP-binding protein | - |
EL199_RS01070 | 241538..242518 | - | 981 | WP_004141168.1 | ABC transporter substrate-binding protein | - |
EL199_RS01075 | 242666..243223 | + | 558 | WP_004141167.1 | RNA 2'-phosphotransferase | - |
EL199_RS01080 | 243497..243898 | - | 402 | WP_004141166.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
EL199_RS01085 | 243898..244131 | - | 234 | WP_004141165.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
EL199_RS01090 | 244463..246016 | + | 1554 | WP_081447823.1 | sodium/proline symporter PutP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15149.44 Da Isoelectric Point: 7.8756
>T287817 WP_004141166.1 NZ_LR134365:c243898-243497 [Cardiobacterium hominis]
MLTYMLDTNTIIYTMKNRPAGMQERFNRLVSQLCISSITAAELCFGVEKSAWPERNRADLEDFFSRLEILPYGLKAAYHY
GNIRFQLQKAGKVIGGNDIHIAAHARSEGLVLISNNLAEFQRVEGLRLENWVV
MLTYMLDTNTIIYTMKNRPAGMQERFNRLVSQLCISSITAAELCFGVEKSAWPERNRADLEDFFSRLEILPYGLKAAYHY
GNIRFQLQKAGKVIGGNDIHIAAHARSEGLVLISNNLAEFQRVEGLRLENWVV
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|