Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK(toxin) |
Location | 3168099..3168657 | Replicon | chromosome |
Accession | NZ_LR134363 | ||
Organism | Actinomyces slackii strain NCTC11923 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A3S4SRE2 |
Locus tag | EL266_RS13095 | Protein ID | WP_026426458.1 |
Coordinates | 3168334..3168657 (+) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | EL266_RS13090 | Protein ID | WP_026426459.1 |
Coordinates | 3168099..3168347 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL266_RS13070 | 3164351..3165115 | - | 765 | WP_026426462.1 | NADH-quinone oxidoreductase subunit C | - |
EL266_RS13075 | 3165112..3165732 | - | 621 | WP_026426461.1 | NADH-quinone oxidoreductase subunit B | - |
EL266_RS13080 | 3165770..3166129 | - | 360 | WP_026426460.1 | NADH-quinone oxidoreductase subunit A | - |
EL266_RS13085 | 3166126..3167493 | - | 1368 | WP_084500523.1 | geranylgeranyl reductase family protein | - |
EL266_RS13090 | 3168099..3168347 | + | 249 | WP_026426459.1 | translation repressor RelB | Antitoxin |
EL266_RS13095 | 3168334..3168657 | + | 324 | WP_026426458.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL266_RS13100 | 3169030..3169413 | - | 384 | WP_126412402.1 | hypothetical protein | - |
EL266_RS13105 | 3169811..3170353 | - | 543 | WP_126412404.1 | hypothetical protein | - |
EL266_RS13110 | 3170553..3171251 | - | 699 | WP_126412406.1 | hypothetical protein | - |
EL266_RS13115 | 3171281..3173443 | - | 2163 | WP_126412408.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11921.90 Da Isoelectric Point: 6.3094
>T287816 WP_026426458.1 NZ_LR134363:3168334-3168657 [Actinomyces slackii]
MLRGEVWTLRDKAYAAKARPVIVVQDETVASFDSIILCLLTTFDMKDAPTRVRIDPDENNGLMKTSYAMTDKIVTVDKKM
LGERVGTIETTQMNAISTQLARLLGIT
MLRGEVWTLRDKAYAAKARPVIVVQDETVASFDSIILCLLTTFDMKDAPTRVRIDPDENNGLMKTSYAMTDKIVTVDKKM
LGERVGTIETTQMNAISTQLARLLGIT
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|