Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1004259..1004773 | Replicon | chromosome |
Accession | NZ_LR134360 | ||
Organism | Staphylococcus condimenti strain NCTC13827 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | EL167_RS04495 | Protein ID | WP_082107871.1 |
Coordinates | 1004423..1004773 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | B9DMI8 |
Locus tag | EL167_RS04490 | Protein ID | WP_015900820.1 |
Coordinates | 1004259..1004426 (+) | Length | 56 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL167_RS04465 | 1000180..1000650 | + | 471 | WP_047132374.1 | PH domain-containing protein | - |
EL167_RS04470 | 1000643..1002115 | + | 1473 | WP_047132375.1 | PH domain-containing protein | - |
EL167_RS04475 | 1002120..1002605 | + | 486 | WP_063164645.1 | PH domain-containing protein | - |
EL167_RS04480 | 1002607..1002960 | + | 354 | WP_047132377.1 | holo-ACP synthase | - |
EL167_RS04485 | 1003024..1004178 | + | 1155 | WP_047132378.1 | alanine racemase | - |
EL167_RS04490 | 1004259..1004426 | + | 168 | WP_015900820.1 | hypothetical protein | Antitoxin |
EL167_RS04495 | 1004423..1004773 | + | 351 | WP_082107871.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL167_RS04500 | 1005041..1006357 | - | 1317 | WP_063164607.1 | ISL3 family transposase | - |
EL167_RS04505 | 1006602..1007603 | + | 1002 | WP_047133046.1 | PP2C family protein-serine/threonine phosphatase | - |
EL167_RS04510 | 1007680..1008006 | + | 327 | WP_015900817.1 | anti-sigma factor antagonist | - |
EL167_RS04515 | 1008008..1008487 | + | 480 | WP_047133045.1 | anti-sigma B factor RsbW | - |
EL167_RS04520 | 1008462..1009232 | + | 771 | WP_047133044.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1005041..1006357 | 1316 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13093.22 Da Isoelectric Point: 10.0708
>T287813 WP_082107871.1 NZ_LR134360:1004423-1004773 [Staphylococcus condimenti]
MMRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAMTGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TVDKKRLKEKLTYLSDEKMKEIDNAIQISLGLTHRN
MMRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAMTGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TVDKKRLKEKLTYLSDEKMKEIDNAIQISLGLTHRN
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|