Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 45416..46101 Replicon chromosome
Accession NZ_LR134358
Organism Neisseria gonorrhoeae strain NCTC13484

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag EL177_RS00335 Protein ID WP_003689143.1
Coordinates 45416..45598 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag EL177_RS00340 Protein ID WP_003691454.1
Coordinates 45700..46101 (+) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL177_RS00300 40515..41321 - 807 WP_050154472.1 replication protein -
EL177_RS13585 41518..41718 - 201 WP_012503750.1 hypothetical protein -
EL177_RS00310 41720..41905 - 186 WP_048654326.1 helix-turn-helix domain-containing protein -
EL177_RS00315 42070..42756 + 687 WP_012503751.1 helix-turn-helix transcriptional regulator -
EL177_RS00320 42796..43494 + 699 WP_002212401.1 helix-turn-helix domain-containing protein -
EL177_RS00325 43733..44431 + 699 WP_048654307.1 hypothetical protein -
EL177_RS00330 44428..45246 + 819 WP_012503752.1 DUF3037 domain-containing protein -
EL177_RS00335 45416..45598 + 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
EL177_RS00340 45700..46101 + 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
EL177_RS00345 46200..46982 - 783 WP_003689146.1 hypothetical protein -
EL177_RS00350 47182..47382 + 201 WP_047917349.1 hypothetical protein -
EL177_RS00355 47415..47891 + 477 WP_002255718.1 hypothetical protein -
EL177_RS00360 47888..48163 + 276 WP_050171366.1 hypothetical protein -
EL177_RS00365 48305..48637 + 333 WP_047923919.1 hypothetical protein -
EL177_RS00370 48791..49066 + 276 WP_047923918.1 hypothetical protein -
EL177_RS00375 49063..49224 + 162 WP_003691530.1 hypothetical protein -
EL177_RS00380 49293..49979 + 687 WP_003693865.1 hypothetical protein -
EL177_RS00385 50120..50302 + 183 WP_003691535.1 hypothetical protein -
EL177_RS00390 50299..50790 + 492 WP_004464807.1 siphovirus Gp157 family protein -
EL177_RS00395 50842..51057 + 216 WP_003691538.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 27633..61285 33652


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T287810 WP_003689143.1 NZ_LR134358:45416-45598 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT287810 WP_003691454.1 NZ_LR134358:45700-46101 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References