Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 5317131..5317819 | Replicon | chromosome |
Accession | NZ_LR134355 | ||
Organism | Mycolicibacterium chitae strain NCTC10485 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EL338_RS25315 | Protein ID | WP_126336367.1 |
Coordinates | 5317382..5317819 (+) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | EL338_RS25310 | Protein ID | WP_126336365.1 |
Coordinates | 5317131..5317385 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL338_RS25285 | 5312351..5313457 | - | 1107 | WP_126336357.1 | NAD(P)/FAD-dependent oxidoreductase | - |
EL338_RS25290 | 5313671..5314420 | - | 750 | WP_126336359.1 | SDR family oxidoreductase | - |
EL338_RS25295 | 5314538..5315095 | + | 558 | WP_126336361.1 | TetR/AcrR family transcriptional regulator | - |
EL338_RS25300 | 5315133..5316521 | - | 1389 | WP_126336363.1 | sodium:alanine symporter family protein | - |
EL338_RS25305 | 5316663..5317007 | - | 345 | WP_126337135.1 | hypothetical protein | - |
EL338_RS25310 | 5317131..5317385 | + | 255 | WP_126336365.1 | antitoxin | Antitoxin |
EL338_RS25315 | 5317382..5317819 | + | 438 | WP_126336367.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EL338_RS25320 | 5317828..5318313 | - | 486 | WP_126336369.1 | SRPBCC domain-containing protein | - |
EL338_RS25325 | 5318318..5318659 | - | 342 | WP_179967135.1 | metalloregulator ArsR/SmtB family transcription factor | - |
EL338_RS25330 | 5318767..5319006 | + | 240 | WP_126336371.1 | hypothetical protein | - |
EL338_RS25335 | 5319011..5320116 | - | 1106 | Protein_5008 | glutamate--cysteine ligase | - |
EL338_RS25340 | 5320214..5320720 | - | 507 | WP_126337139.1 | peptidoglycan recognition protein family protein | - |
EL338_RS25345 | 5321211..5322797 | + | 1587 | WP_126336373.1 | serine/threonine protein kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15442.55 Da Isoelectric Point: 6.7582
>T287809 WP_126336367.1 NZ_LR134355:5317382-5317819 [Mycolicibacterium chitae]
VKIVDANVLLYAVNSASPQHEASRRWLDGALSGSDTVGLAWVPLLAFVRLSTKTGLFPSPLPPADAMRQVVEWATAPGAT
TIAPTARHGDILHTLLAQLGTGGNIVSDAHLAALAIEHRASIVSYDNDFSRFDGVRWHTPDALVK
VKIVDANVLLYAVNSASPQHEASRRWLDGALSGSDTVGLAWVPLLAFVRLSTKTGLFPSPLPPADAMRQVVEWATAPGAT
TIAPTARHGDILHTLLAQLGTGGNIVSDAHLAALAIEHRASIVSYDNDFSRFDGVRWHTPDALVK
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|