Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 4292460..4293033 | Replicon | chromosome |
Accession | NZ_LR134355 | ||
Organism | Mycolicibacterium chitae strain NCTC10485 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | EL338_RS20640 | Protein ID | WP_126335451.1 |
Coordinates | 4292683..4293033 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | EL338_RS20635 | Protein ID | WP_126335450.1 |
Coordinates | 4292460..4292696 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL338_RS20615 | 4289173..4289490 | + | 318 | WP_126335447.1 | WhiB family transcriptional regulator | - |
EL338_RS20620 | 4289519..4290025 | + | 507 | WP_126335448.1 | cupin domain-containing protein | - |
EL338_RS20625 | 4290160..4291860 | + | 1701 | WP_126335449.1 | DEAD/DEAH box helicase | - |
EL338_RS20635 | 4292460..4292696 | + | 237 | WP_126335450.1 | antitoxin | Antitoxin |
EL338_RS20640 | 4292683..4293033 | + | 351 | WP_126335451.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL338_RS20645 | 4293123..4293941 | - | 819 | WP_126335452.1 | adenylate/guanylate cyclase domain-containing protein | - |
EL338_RS20650 | 4293981..4294478 | - | 498 | WP_126335453.1 | polyketide cyclase | - |
EL338_RS20655 | 4294531..4295346 | - | 816 | WP_126335454.1 | HAD-IIA family hydrolase | - |
EL338_RS20660 | 4295379..4296830 | - | 1452 | WP_126335455.1 | PH domain-containing protein | - |
EL338_RS20665 | 4296827..4297303 | - | 477 | WP_126336996.1 | PH domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12207.17 Da Isoelectric Point: 10.6484
>T287808 WP_126335451.1 NZ_LR134355:4292683-4293033 [Mycolicibacterium chitae]
MASTEDPRRGQLWLVALGAARPGEPGKHRPAVIVSTEQLLTGEAAELVVVVPVSSSRVATPLRPTLTAADGVDADSVAVC
RAVRGVARARLVRRLGTLSESTMGQVDRALKMILDL
MASTEDPRRGQLWLVALGAARPGEPGKHRPAVIVSTEQLLTGEAAELVVVVPVSSSRVATPLRPTLTAADGVDADSVAVC
RAVRGVARARLVRRLGTLSESTMGQVDRALKMILDL
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|