Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-PHD |
Location | 2558051..2558739 | Replicon | chromosome |
Accession | NZ_LR134355 | ||
Organism | Mycolicibacterium chitae strain NCTC10485 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EL338_RS12055 | Protein ID | WP_126333967.1 |
Coordinates | 2558051..2558464 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | EL338_RS12060 | Protein ID | WP_126333968.1 |
Coordinates | 2558461..2558739 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL338_RS12035 | 2553962..2554237 | - | 276 | WP_126333963.1 | hypothetical protein | - |
EL338_RS12040 | 2554514..2555053 | - | 540 | WP_126333964.1 | hypothetical protein | - |
EL338_RS12045 | 2555360..2556556 | + | 1197 | WP_126333965.1 | hypothetical protein | - |
EL338_RS12050 | 2556575..2558041 | + | 1467 | WP_126333966.1 | wax ester/triacylglycerol synthase family O-acyltransferase | - |
EL338_RS12055 | 2558051..2558464 | - | 414 | WP_126333967.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EL338_RS12060 | 2558461..2558739 | - | 279 | WP_126333968.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
EL338_RS12065 | 2558870..2559688 | + | 819 | WP_126333969.1 | TIGR03560 family F420-dependent LLM class oxidoreductase | - |
EL338_RS12070 | 2560124..2561824 | + | 1701 | WP_126333970.1 | class I poly(R)-hydroxyalkanoic acid synthase | - |
EL338_RS12075 | 2561935..2563155 | - | 1221 | WP_126333971.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2552341..2553591 | 1250 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14857.94 Da Isoelectric Point: 4.7569
>T287807 WP_126333967.1 NZ_LR134355:c2558464-2558051 [Mycolicibacterium chitae]
MIYLDTSALTKLLVAEAETPDLQSWLLEQRDHGEDHAVTSALGRVELMRAVARLGEPGLHERALYLLDGLDILPLTDAVI
TLAETIGPARLRSLDAIHLASAAQIRRELTTFVTYDHRLLEGCRAVGFDTASPGGSA
MIYLDTSALTKLLVAEAETPDLQSWLLEQRDHGEDHAVTSALGRVELMRAVARLGEPGLHERALYLLDGLDILPLTDAVI
TLAETIGPARLRSLDAIHLASAAQIRRELTTFVTYDHRLLEGCRAVGFDTASPGGSA
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|