Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 2550742..2551277 | Replicon | chromosome |
Accession | NZ_LR134355 | ||
Organism | Mycolicibacterium chitae strain NCTC10485 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | EL338_RS12020 | Protein ID | WP_126333961.1 |
Coordinates | 2550945..2551277 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | EL338_RS12015 | Protein ID | WP_126333960.1 |
Coordinates | 2550742..2550948 (+) | Length | 69 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL338_RS11985 | 2546871..2547485 | + | 615 | WP_126336824.1 | hypothetical protein | - |
EL338_RS11990 | 2547600..2547845 | + | 246 | WP_126333955.1 | plasmid stabilization protein | - |
EL338_RS11995 | 2547842..2548270 | + | 429 | WP_126333956.1 | type II toxin-antitoxin system VapC family toxin | - |
EL338_RS12000 | 2548399..2548608 | - | 210 | WP_126333957.1 | hypothetical protein | - |
EL338_RS12005 | 2548806..2549813 | - | 1008 | WP_126333958.1 | zinc-dependent alcohol dehydrogenase family protein | - |
EL338_RS12010 | 2550071..2550622 | - | 552 | WP_126333959.1 | YaeQ family protein | - |
EL338_RS12015 | 2550742..2550948 | + | 207 | WP_126333960.1 | DUF3018 family protein | Antitoxin |
EL338_RS12020 | 2550945..2551277 | + | 333 | WP_126333961.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL338_RS12025 | 2551829..2552254 | - | 426 | WP_126333962.1 | hypothetical protein | - |
EL338_RS12030 | 2552341..2553591 | - | 1251 | WP_126333404.1 | IS256 family transposase | - |
EL338_RS12035 | 2553962..2554237 | - | 276 | WP_126333963.1 | hypothetical protein | - |
EL338_RS12040 | 2554514..2555053 | - | 540 | WP_126333964.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2545469..2546719 | 1250 | |
- | flank | IS/Tn | - | - | 2552341..2553591 | 1250 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11876.67 Da Isoelectric Point: 7.2039
>T287806 WP_126333961.1 NZ_LR134355:2550945-2551277 [Mycolicibacterium chitae]
VNRGEIWTVAGGIYAGKSRPAVIVQDDLFDATGSVTVAPMTSTLLDAPLMRIRITGGQGRLSGLDHDSDVMIDQLTTVRR
SNVHVRVGRLTAEQVVEVERAMMAFLGLAR
VNRGEIWTVAGGIYAGKSRPAVIVQDDLFDATGSVTVAPMTSTLLDAPLMRIRITGGQGRLSGLDHDSDVMIDQLTTVRR
SNVHVRVGRLTAEQVVEVERAMMAFLGLAR
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|