Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-CcdA |
Location | 1896023..1896642 | Replicon | chromosome |
Accession | NZ_LR134355 | ||
Organism | Mycolicibacterium chitae strain NCTC10485 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EL338_RS08960 | Protein ID | WP_126336755.1 |
Coordinates | 1896265..1896642 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | EL338_RS08955 | Protein ID | WP_126333443.1 |
Coordinates | 1896023..1896241 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL338_RS08930 | 1891829..1892779 | + | 951 | WP_126333438.1 | alpha/beta fold hydrolase | - |
EL338_RS08935 | 1892776..1893402 | + | 627 | WP_126333439.1 | TetR/AcrR family transcriptional regulator | - |
EL338_RS08940 | 1893404..1893949 | - | 546 | WP_163792083.1 | DUF4333 domain-containing protein | - |
EL338_RS08945 | 1893949..1895388 | - | 1440 | WP_126333441.1 | peptidase | - |
EL338_RS08950 | 1895490..1895996 | + | 507 | WP_126333442.1 | O-acetyl-ADP-ribose deacetylase | - |
EL338_RS08955 | 1896023..1896241 | + | 219 | WP_126333443.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
EL338_RS08960 | 1896265..1896642 | + | 378 | WP_126336755.1 | PIN domain-containing protein | Toxin |
EL338_RS08965 | 1896683..1897630 | + | 948 | WP_126333444.1 | mechanosensitive ion channel family protein | - |
EL338_RS08970 | 1897634..1899253 | - | 1620 | WP_126333445.1 | peptide chain release factor 3 | - |
EL338_RS08975 | 1899445..1899735 | + | 291 | WP_126333446.1 | hypothetical protein | - |
EL338_RS08980 | 1899761..1900597 | + | 837 | WP_126333447.1 | universal stress protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13377.43 Da Isoelectric Point: 6.7266
>T287804 WP_126336755.1 NZ_LR134355:1896265-1896642 [Mycolicibacterium chitae]
VVIDASAMVDLVARTDRFAAVRARLARTVMHAPAHFDAEVLSALGRLQRAAVLTVAEVDAALDELRQAPVTRHALPSLLS
GAWARRDTLRLADALYVELAETAGLTLLTTDQRLARAAQVADVIA
VVIDASAMVDLVARTDRFAAVRARLARTVMHAPAHFDAEVLSALGRLQRAAVLTVAEVDAALDELRQAPVTRHALPSLLS
GAWARRDTLRLADALYVELAETAGLTLLTTDQRLARAAQVADVIA
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|