Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 1889233..1889876 | Replicon | chromosome |
Accession | NZ_LR134355 | ||
Organism | Mycolicibacterium chitae strain NCTC10485 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EL338_RS08920 | Protein ID | WP_126333436.1 |
Coordinates | 1889487..1889876 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | EL338_RS08915 | Protein ID | WP_126333435.1 |
Coordinates | 1889233..1889487 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL338_RS08885 | 1884981..1885352 | - | 372 | WP_126333430.1 | STAS/SEC14 domain-containing protein | - |
EL338_RS08890 | 1885442..1886110 | + | 669 | WP_126333431.1 | thioredoxin domain-containing protein | - |
EL338_RS08895 | 1886121..1886432 | - | 312 | WP_126336754.1 | hypothetical protein | - |
EL338_RS08900 | 1886547..1887992 | - | 1446 | WP_126333432.1 | ADP-ribosylglycohydrolase family protein | - |
EL338_RS08905 | 1888011..1888346 | - | 336 | WP_126333433.1 | DUF732 domain-containing protein | - |
EL338_RS08910 | 1888583..1889185 | + | 603 | WP_126333434.1 | DUF2510 domain-containing protein | - |
EL338_RS08915 | 1889233..1889487 | + | 255 | WP_126333435.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
EL338_RS08920 | 1889487..1889876 | + | 390 | WP_126333436.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EL338_RS08925 | 1890468..1891832 | + | 1365 | WP_126333437.1 | NAD(P)-binding domain-containing protein | - |
EL338_RS08930 | 1891829..1892779 | + | 951 | WP_126333438.1 | alpha/beta fold hydrolase | - |
EL338_RS08935 | 1892776..1893402 | + | 627 | WP_126333439.1 | TetR/AcrR family transcriptional regulator | - |
EL338_RS08940 | 1893404..1893949 | - | 546 | WP_163792083.1 | DUF4333 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13945.75 Da Isoelectric Point: 4.5486
>T287803 WP_126333436.1 NZ_LR134355:1889487-1889876 [Mycolicibacterium chitae]
MVIDTSALVAMLTDEADAVLLEARVAEDPVRTMSTASYLETAIVIEARYGEAGGRELDLWLHRASVDLVPVTADQAEVAR
RAYRQYGKGCHPAGLNYGDCFSYALAKVNGQPLLFKGDGFQHTDVVAAQ
MVIDTSALVAMLTDEADAVLLEARVAEDPVRTMSTASYLETAIVIEARYGEAGGRELDLWLHRASVDLVPVTADQAEVAR
RAYRQYGKGCHPAGLNYGDCFSYALAKVNGQPLLFKGDGFQHTDVVAAQ
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|