Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
Location | 813578..814238 | Replicon | chromosome |
Accession | NZ_LR134355 | ||
Organism | Mycolicibacterium chitae strain NCTC10485 |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | - |
Locus tag | EL338_RS03870 | Protein ID | WP_126332524.1 |
Coordinates | 813804..814238 (+) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | - |
Locus tag | EL338_RS03865 | Protein ID | WP_126332523.1 |
Coordinates | 813578..813790 (+) | Length | 71 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL338_RS03855 | 809652..811130 | + | 1479 | WP_126336664.1 | serine hydrolase | - |
EL338_RS03860 | 811127..813532 | + | 2406 | WP_126332522.1 | cation-translocating P-type ATPase | - |
EL338_RS03865 | 813578..813790 | + | 213 | WP_126332523.1 | antitoxin | Antitoxin |
EL338_RS03870 | 813804..814238 | + | 435 | WP_126332524.1 | SRPBCC family protein | Toxin |
EL338_RS03875 | 814248..815822 | - | 1575 | WP_179967159.1 | GAF domain-containing sensor histidine kinase | - |
EL338_RS03880 | 815815..816465 | - | 651 | WP_126332525.1 | response regulator transcription factor | - |
EL338_RS03885 | 816475..816825 | - | 351 | WP_126332526.1 | hypothetical protein | - |
EL338_RS03890 | 816860..817297 | - | 438 | WP_126332527.1 | cupin domain-containing protein | - |
EL338_RS03895 | 817421..818971 | + | 1551 | WP_126332528.1 | ATP-binding cassette domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15596.18 Da Isoelectric Point: 9.8777
>T287802 WP_126332524.1 NZ_LR134355:813804-814238 [Mycolicibacterium chitae]
VAKLSVSVDVPLPPEQAWECAADLSRYKEWLTIHRVWRSALPETLEKGTTLDSIVEVKGMANRVKWTIVHYKPPQAMTLN
GDGRGGVKIKLMAKITPKGDGSVVTFDTHLGGPALFGPIGMVVAGALKGDIRESLNNFVKVFTG
VAKLSVSVDVPLPPEQAWECAADLSRYKEWLTIHRVWRSALPETLEKGTTLDSIVEVKGMANRVKWTIVHYKPPQAMTLN
GDGRGGVKIKLMAKITPKGDGSVVTFDTHLGGPALFGPIGMVVAGALKGDIRESLNNFVKVFTG
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|