Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-RelB |
| Location | 1831787..1832342 | Replicon | chromosome |
| Accession | NZ_LR134354 | ||
| Organism | Bifidobacterium longum subsp. infantis strain NCTC11817 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | B7GSS5 |
| Locus tag | EL189_RS09165 | Protein ID | WP_003833460.1 |
| Coordinates | 1832019..1832342 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S2ZDC4 |
| Locus tag | EL189_RS09160 | Protein ID | WP_003829112.1 |
| Coordinates | 1831787..1832032 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL189_RS09140 | 1827614..1828276 | + | 663 | WP_012577980.1 | TetR/AcrR family transcriptional regulator | - |
| EL189_RS09145 | 1828433..1829704 | + | 1272 | WP_012577981.1 | MFS transporter | - |
| EL189_RS09150 | 1829888..1830092 | - | 205 | Protein_1712 | XRE family transcriptional regulator | - |
| EL189_RS09155 | 1830357..1831613 | - | 1257 | WP_003829116.1 | HipA domain-containing protein | - |
| EL189_RS09160 | 1831787..1832032 | + | 246 | WP_003829112.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| EL189_RS09165 | 1832019..1832342 | + | 324 | WP_003833460.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EL189_RS09170 | 1832559..1833173 | - | 615 | WP_012577983.1 | cupin domain-containing protein | - |
| EL189_RS09175 | 1833267..1834136 | - | 870 | WP_003829104.1 | class I SAM-dependent methyltransferase | - |
| EL189_RS09180 | 1834374..1834739 | + | 366 | WP_012577984.1 | YccF domain-containing protein | - |
| EL189_RS09190 | 1835269..1836534 | + | 1266 | WP_012577985.1 | Fic family protein | - |
| EL189_RS09200 | 1837004..1837302 | + | 299 | Protein_1720 | IS256 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11829.64 Da Isoelectric Point: 6.2932
>T287800 WP_003833460.1 NZ_LR134354:1832019-1832342 [Bifidobacterium longum subsp. infantis]
MKRGEIRTLQADGYASKPRPVVIVQSDAVDRFDSVITCLLTSYDSSDIDTRVRLEPSPENGLNKVSYVMTDKIVTVDRKL
LGYQVGVVDDAAMANIGRQLMRVLGLL
MKRGEIRTLQADGYASKPRPVVIVQSDAVDRFDSVITCLLTSYDSSDIDTRVRLEPSPENGLNKVSYVMTDKIVTVDRKL
LGYQVGVVDDAAMANIGRQLMRVLGLL
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4R0SL31 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A087B6Q6 |