Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
| Location | 14946..15511 | Replicon | chromosome |
| Accession | NZ_LR134354 | ||
| Organism | Bifidobacterium longum subsp. infantis strain NCTC11817 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | B7GSH0 |
| Locus tag | EL189_RS00065 | Protein ID | WP_012576472.1 |
| Coordinates | 14946..15236 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | B7GSH1 |
| Locus tag | EL189_RS00070 | Protein ID | WP_012576473.1 |
| Coordinates | 15233..15511 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL189_RS00040 | 10155..10721 | + | 567 | WP_012576468.1 | DUF3566 domain-containing protein | - |
| EL189_RS00050 | 11367..12788 | + | 1422 | WP_012576469.1 | ATP-binding protein | - |
| EL189_RS00055 | 12849..13073 | - | 225 | WP_012576470.1 | hypothetical protein | - |
| EL189_RS00060 | 13224..14570 | - | 1347 | WP_012576471.1 | NADP-specific glutamate dehydrogenase | - |
| EL189_RS00065 | 14946..15236 | - | 291 | WP_012576472.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| EL189_RS00070 | 15233..15511 | - | 279 | WP_012576473.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| EL189_RS00075 | 15934..16338 | + | 405 | WP_126386265.1 | hypothetical protein | - |
| EL189_RS00080 | 16343..16738 | - | 396 | WP_014484455.1 | transposase | - |
| EL189_RS00085 | 17078..17722 | + | 645 | WP_012576475.1 | hypothetical protein | - |
| EL189_RS00090 | 18144..18335 | - | 192 | WP_126386268.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10835.59 Da Isoelectric Point: 10.3137
>T287795 WP_012576472.1 NZ_LR134354:c15236-14946 [Bifidobacterium longum subsp. infantis]
MSGIRYTVKTTSRFRKDFKLARRRGLDAGLFKQVVSILSEGGTLPDRYHDHALTGNMTGFRECYITPDLLLVYLIEKDVL
VLTLTRTGTHSGLFGK
MSGIRYTVKTTSRFRKDFKLARRRGLDAGLFKQVVSILSEGGTLPDRYHDHALTGNMTGFRECYITPDLLLVYLIEKDVL
VLTLTRTGTHSGLFGK
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | B7GSH0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A8MHE5 |