Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 1851941..1852577 | Replicon | chromosome |
Accession | NZ_LR134352 | ||
Organism | Nocardia asteroides strain NCTC11293 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U5EBJ0 |
Locus tag | EL493_RS08615 | Protein ID | WP_019045202.1 |
Coordinates | 1851941..1852348 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U5EM71 |
Locus tag | EL493_RS08620 | Protein ID | WP_019045203.1 |
Coordinates | 1852338..1852577 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL493_RS08600 | 1849744..1850730 | + | 987 | WP_019045199.1 | M48 family metalloprotease | - |
EL493_RS08605 | 1850790..1851752 | + | 963 | WP_022567285.1 | DUF4349 domain-containing protein | - |
EL493_RS08610 | 1851712..1851939 | + | 228 | WP_019045201.1 | DUF167 domain-containing protein | - |
EL493_RS08615 | 1851941..1852348 | - | 408 | WP_019045202.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EL493_RS08620 | 1852338..1852577 | - | 240 | WP_019045203.1 | hypothetical protein | Antitoxin |
EL493_RS08625 | 1852611..1853075 | - | 465 | WP_019045204.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
EL493_RS08630 | 1853092..1853490 | + | 399 | WP_081723256.1 | DUF3017 domain-containing protein | - |
EL493_RS08635 | 1853483..1854130 | - | 648 | WP_019045206.1 | nitroreductase family protein | - |
EL493_RS08640 | 1854200..1854577 | + | 378 | WP_019045207.1 | helix-turn-helix transcriptional regulator | - |
EL493_RS08645 | 1854615..1855577 | - | 963 | WP_019045208.1 | DUF2236 domain-containing protein | - |
EL493_RS08650 | 1855675..1856373 | + | 699 | WP_126405629.1 | TetR/AcrR family transcriptional regulator | - |
EL493_RS08655 | 1856377..1857525 | - | 1149 | WP_019045210.1 | homoserine O-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14745.93 Da Isoelectric Point: 6.6367
>T287793 WP_019045202.1 NZ_LR134352:c1852348-1851941 [Nocardia asteroides]
VASDEYVLDGSAASTALLRKDAVGIAVGRLIETSTCHAPHLIDAEVGNVLRRHERKGLVDPETATIGLRMLATMVDRRYA
HQGWLSEQAWLLRHTITFYDGLYAALAARLDVPLLTSDARLSKAPGLPCRVEVID
VASDEYVLDGSAASTALLRKDAVGIAVGRLIETSTCHAPHLIDAEVGNVLRRHERKGLVDPETATIGLRMLATMVDRRYA
HQGWLSEQAWLLRHTITFYDGLYAALAARLDVPLLTSDARLSKAPGLPCRVEVID
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|