Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1952145..1952674 | Replicon | chromosome |
Accession | NZ_LR134351 | ||
Organism | Staphylococcus aureus strain NCTC13811 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q6GF05 |
Locus tag | EL160_RS10410 | Protein ID | WP_000621176.1 |
Coordinates | 1952145..1952507 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | EL160_RS10415 | Protein ID | WP_000948331.1 |
Coordinates | 1952504..1952674 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL160_RS10385 | 1949124..1949894 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
EL160_RS10390 | 1949869..1950348 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
EL160_RS10395 | 1950350..1950676 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
EL160_RS10400 | 1950795..1951796 | - | 1002 | WP_129545277.1 | PP2C family protein-serine/threonine phosphatase | - |
EL160_RS10410 | 1952145..1952507 | - | 363 | WP_000621176.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL160_RS10415 | 1952504..1952674 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
EL160_RS10420 | 1952759..1953907 | - | 1149 | WP_001281140.1 | alanine racemase | - |
EL160_RS10425 | 1953973..1954332 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
EL160_RS10430 | 1954336..1954827 | - | 492 | WP_001286801.1 | PH domain-containing protein | - |
EL160_RS10435 | 1954820..1956397 | - | 1578 | WP_001294646.1 | PH domain-containing protein | - |
EL160_RS10440 | 1956390..1956869 | - | 480 | WP_001287082.1 | hypothetical protein | - |
EL160_RS10445 | 1957078..1957638 | - | 561 | WP_001092414.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13469.74 Da Isoelectric Point: 10.1654
>T287782 WP_000621176.1 NZ_LR134351:c1952507-1952145 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVVHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVVHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A168PYX0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0VRZ1 |