Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-RelB |
| Location | 1202963..1203529 | Replicon | chromosome |
| Accession | NZ_LR134348 | ||
| Organism | Bifidobacterium breve strain NCTC11815 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | D4BPQ4 |
| Locus tag | EL174_RS05430 | Protein ID | WP_003829417.1 |
| Coordinates | 1203236..1203529 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0L7C7C8 |
| Locus tag | EL174_RS05425 | Protein ID | WP_014483711.1 |
| Coordinates | 1202963..1203232 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL174_RS05400 | 1198712..1199407 | - | 696 | WP_003829410.1 | response regulator transcription factor | - |
| EL174_RS05405 | 1199533..1200048 | + | 516 | WP_013140733.1 | hypothetical protein | - |
| EL174_RS05410 | 1200045..1200935 | + | 891 | WP_003829412.1 | hypothetical protein | - |
| EL174_RS05415 | 1200932..1201612 | + | 681 | WP_003829413.1 | ABC transporter ATP-binding protein | - |
| EL174_RS05420 | 1201609..1202778 | + | 1170 | WP_050755802.1 | ABC transporter permease | - |
| EL174_RS05425 | 1202963..1203232 | + | 270 | WP_014483711.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| EL174_RS05430 | 1203236..1203529 | + | 294 | WP_003829417.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| EL174_RS10420 | 1203535..1203834 | - | 300 | WP_003829418.1 | hypothetical protein | - |
| EL174_RS05440 | 1204197..1204748 | + | 552 | WP_050755804.1 | RNA polymerase sigma factor | - |
| EL174_RS05445 | 1204782..1205609 | + | 828 | WP_003829422.1 | hypothetical protein | - |
| EL174_RS05450 | 1205742..1206368 | + | 627 | WP_003829423.1 | hypothetical protein | - |
| EL174_RS05455 | 1206365..1207147 | + | 783 | WP_003829424.1 | hypothetical protein | - |
| EL174_RS05460 | 1207200..1208075 | + | 876 | WP_003829425.1 | ABC transporter ATP-binding protein | - |
| EL174_RS05465 | 1208129..1208527 | + | 399 | WP_003829426.1 | superoxide dismutase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1196865..1222395 | 25530 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11188.92 Da Isoelectric Point: 9.8306
>T287767 WP_003829417.1 NZ_LR134348:1203236-1203529 [Bifidobacterium breve]
MLKPDYTAAFQRDIKKLKRKHADLRPLKEVIRLVLEDTADSKEALRRRHRAHTLTGDLNGVLECHIGNAGDWLLLWIRDD
GTAMFMRTGSHDELLGR
MLKPDYTAAFQRDIKKLKRKHADLRPLKEVIRLVLEDTADSKEALRRRHRAHTLTGDLNGVLECHIGNAGDWLLLWIRDD
GTAMFMRTGSHDELLGR
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0L7C7H2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0L7C7C8 |