Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/RelB(antitoxin) |
Location | 1026457..1027093 | Replicon | chromosome |
Accession | NZ_LR134348 | ||
Organism | Bifidobacterium breve strain NCTC11815 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | D4BP71 |
Locus tag | EL174_RS04550 | Protein ID | WP_003829234.1 |
Coordinates | 1026457..1026813 (-) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | D6PAX1 |
Locus tag | EL174_RS04555 | Protein ID | WP_012577921.1 |
Coordinates | 1026800..1027093 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL174_RS04520 | 1021648..1022559 | + | 912 | WP_003829224.1 | ABC transporter ATP-binding protein | - |
EL174_RS04525 | 1022756..1023382 | + | 627 | WP_003829226.1 | 30S ribosomal protein S4 | - |
EL174_RS04530 | 1023719..1024501 | - | 783 | WP_003829227.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
EL174_RS04535 | 1024642..1025127 | - | 486 | WP_003829229.1 | cytidine deaminase | - |
EL174_RS04540 | 1025217..1025573 | + | 357 | WP_003829232.1 | SdpI family protein | - |
EL174_RS04545 | 1025678..1026280 | + | 603 | WP_003829233.1 | transglutaminase family protein | - |
EL174_RS04550 | 1026457..1026813 | - | 357 | WP_003829234.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL174_RS04555 | 1026800..1027093 | - | 294 | WP_012577921.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
EL174_RS04560 | 1027244..1027408 | - | 165 | Protein_840 | IS30 family transposase | - |
EL174_RS04565 | 1027508..1028182 | + | 675 | WP_032738178.1 | histidine phosphatase family protein | - |
EL174_RS04570 | 1028265..1028669 | + | 405 | WP_003829238.1 | DUF948 domain-containing protein | - |
EL174_RS04575 | 1028669..1028905 | + | 237 | WP_003829239.1 | hypothetical protein | - |
EL174_RS04580 | 1029001..1031679 | + | 2679 | WP_003829240.1 | alanine--tRNA ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13316.23 Da Isoelectric Point: 7.9984
>T287766 WP_003829234.1 NZ_LR134348:c1026813-1026457 [Bifidobacterium breve]
MMKTDPHQFEIWWVPFTFPDKPGKAKNRPSVILQWDDGTRIALVTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSSLFLDDGPTGRLSAYDAGRVTWAINELYPGLLA
MMKTDPHQFEIWWVPFTFPDKPGKAKNRPSVILQWDDGTRIALVTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSSLFLDDGPTGRLSAYDAGRVTWAINELYPGLLA
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0L7B6G7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S2VTZ6 |