Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-RelB |
| Location | 967145..967700 | Replicon | chromosome |
| Accession | NZ_LR134348 | ||
| Organism | Bifidobacterium breve strain NCTC11815 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S2ZXD7 |
| Locus tag | EL174_RS04265 | Protein ID | WP_003829109.1 |
| Coordinates | 967145..967468 (-) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S2ZDC4 |
| Locus tag | EL174_RS04270 | Protein ID | WP_003829112.1 |
| Coordinates | 967455..967700 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL174_RS04230 | 962182..962470 | - | 289 | Protein_778 | IS256 family transposase | - |
| EL174_RS04240 | 962941..964206 | - | 1266 | WP_003829096.1 | Fic family protein | - |
| EL174_RS04250 | 964748..965113 | - | 366 | WP_032738175.1 | YccF domain-containing protein | - |
| EL174_RS04255 | 965351..966220 | + | 870 | WP_003829104.1 | class I SAM-dependent methyltransferase | - |
| EL174_RS04260 | 966314..966928 | + | 615 | WP_003829107.1 | cupin domain-containing protein | - |
| EL174_RS04265 | 967145..967468 | - | 324 | WP_003829109.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EL174_RS04270 | 967455..967700 | - | 246 | WP_003829112.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| EL174_RS04275 | 967874..969130 | + | 1257 | WP_003829116.1 | HipA domain-containing protein | - |
| EL174_RS04280 | 969395..969586 | + | 192 | WP_003829118.1 | hypothetical protein | - |
| EL174_RS04285 | 969770..971041 | - | 1272 | WP_003829121.1 | MFS transporter | - |
| EL174_RS04290 | 971198..971860 | - | 663 | WP_025262926.1 | TetR/AcrR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 956914..1005199 | 48285 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11859.67 Da Isoelectric Point: 5.0771
>T287765 WP_003829109.1 NZ_LR134348:c967468-967145 [Bifidobacterium breve]
MKRGEIWTLQADGYASKPRPVVIVQSDAVDRFDSVITCLLTSYDSSDIDTRVRLEPSPENGLNKVSYVMTDKIVTVDRKL
LGYQVGVVDDAAMANIGRQLMRVLGLL
MKRGEIWTLQADGYASKPRPVVIVQSDAVDRFDSVITCLLTSYDSSDIDTRVRLEPSPENGLNKVSYVMTDKIVTVDRKL
LGYQVGVVDDAAMANIGRQLMRVLGLL
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A087B6Q7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A087B6Q6 |