Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 3115282..3115787 Replicon chromosome
Accession NZ_LR134342
Organism Pseudomonas aeruginosa strain NCTC10728

Toxin (Protein)


Gene name parE Uniprot ID A0A069QL22
Locus tag EL327_RS14940 Protein ID WP_003121619.1
Coordinates 3115282..3115563 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A1C7BDS9
Locus tag EL327_RS14945 Protein ID WP_003083775.1
Coordinates 3115560..3115787 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL327_RS14915 3110533..3111882 + 1350 WP_003142411.1 C4-dicarboxylate transporter DctA -
EL327_RS14920 3111931..3112617 + 687 WP_003083762.1 FadR family transcriptional regulator -
EL327_RS14925 3112718..3113452 + 735 WP_004346926.1 GntR family transcriptional regulator -
EL327_RS14930 3113656..3114042 + 387 WP_014602345.1 aegerolysin family protein -
EL327_RS14935 3114074..3114982 - 909 WP_003083769.1 LysR family transcriptional regulator -
EL327_RS14940 3115282..3115563 - 282 WP_003121619.1 type II toxin-antitoxin system toxin ParE Toxin
EL327_RS14945 3115560..3115787 - 228 WP_003083775.1 CopG family ribbon-helix-helix protein Antitoxin
EL327_RS14950 3115963..3116583 - 621 WP_003101226.1 hypothetical protein -
EL327_RS14955 3116684..3117184 + 501 WP_003101228.1 LEA type 2 family protein -
EL327_RS14960 3117257..3117598 + 342 WP_003101229.1 alkylphosphonate utilization protein -
EL327_RS14965 3117680..3119107 - 1428 WP_003083784.1 GABA permease -
EL327_RS14970 3119276..3120769 - 1494 WP_003101230.1 CoA-acylating methylmalonate-semialdehyde dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-87)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10492.22 Da        Isoelectric Point: 10.0435

>T287763 WP_003121619.1 NZ_LR134342:c3115563-3115282 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP

Download         Length: 282 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8556.58 Da        Isoelectric Point: 5.5740

>AT287763 WP_003083775.1 NZ_LR134342:c3115787-3115560 [Pseudomonas aeruginosa]
MSTVVSFRADDALVAALDELARATHRDRPYHLRQALAQYLERQQWQVAAIDEGLADANAGRLLEHTEIEKRWGLQ

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A069QL22

Antitoxin

Source ID Structure
AlphaFold DB A0A1C7BDS9

References