Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 3115282..3115787 | Replicon | chromosome |
Accession | NZ_LR134342 | ||
Organism | Pseudomonas aeruginosa strain NCTC10728 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A069QL22 |
Locus tag | EL327_RS14940 | Protein ID | WP_003121619.1 |
Coordinates | 3115282..3115563 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | EL327_RS14945 | Protein ID | WP_003083775.1 |
Coordinates | 3115560..3115787 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL327_RS14915 | 3110533..3111882 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
EL327_RS14920 | 3111931..3112617 | + | 687 | WP_003083762.1 | FadR family transcriptional regulator | - |
EL327_RS14925 | 3112718..3113452 | + | 735 | WP_004346926.1 | GntR family transcriptional regulator | - |
EL327_RS14930 | 3113656..3114042 | + | 387 | WP_014602345.1 | aegerolysin family protein | - |
EL327_RS14935 | 3114074..3114982 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
EL327_RS14940 | 3115282..3115563 | - | 282 | WP_003121619.1 | type II toxin-antitoxin system toxin ParE | Toxin |
EL327_RS14945 | 3115560..3115787 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
EL327_RS14950 | 3115963..3116583 | - | 621 | WP_003101226.1 | hypothetical protein | - |
EL327_RS14955 | 3116684..3117184 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
EL327_RS14960 | 3117257..3117598 | + | 342 | WP_003101229.1 | alkylphosphonate utilization protein | - |
EL327_RS14965 | 3117680..3119107 | - | 1428 | WP_003083784.1 | GABA permease | - |
EL327_RS14970 | 3119276..3120769 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10492.22 Da Isoelectric Point: 10.0435
>T287763 WP_003121619.1 NZ_LR134342:c3115563-3115282 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A069QL22 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1C7BDS9 |