Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 1398891..1399377 | Replicon | chromosome |
| Accession | NZ_LR134341 | ||
| Organism | Streptococcus pseudoporcinus strain NCTC13786 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G5K852 |
| Locus tag | EL147_RS06810 | Protein ID | WP_007892295.1 |
| Coordinates | 1398891..1399160 (-) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G5K853 |
| Locus tag | EL147_RS06815 | Protein ID | WP_007892538.1 |
| Coordinates | 1399150..1399377 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL147_RS06795 | 1394689..1395291 | - | 603 | WP_007892530.1 | NAD(P)H-dependent oxidoreductase | - |
| EL147_RS06800 | 1395472..1395831 | + | 360 | WP_007892340.1 | YbaN family protein | - |
| EL147_RS06805 | 1396390..1397881 | + | 1492 | Protein_1263 | IS1182 family transposase | - |
| EL147_RS06810 | 1398891..1399160 | - | 270 | WP_007892295.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL147_RS06815 | 1399150..1399377 | - | 228 | WP_007892538.1 | hypothetical protein | Antitoxin |
| EL147_RS06820 | 1399562..1399864 | - | 303 | WP_007892306.1 | hypothetical protein | - |
| EL147_RS06825 | 1399855..1400343 | - | 489 | WP_176602242.1 | hypothetical protein | - |
| EL147_RS06830 | 1400408..1400671 | - | 264 | WP_007892271.1 | hypothetical protein | - |
| EL147_RS06835 | 1400810..1401004 | - | 195 | WP_007892513.1 | DnaD domain protein | - |
| EL147_RS06840 | 1400950..1401337 | - | 388 | Protein_1270 | phage replisome organizer N-terminal domain-containing protein | - |
| EL147_RS06845 | 1401322..1401639 | - | 318 | WP_007892369.1 | hypothetical protein | - |
| EL147_RS06850 | 1401641..1401973 | - | 333 | WP_007892612.1 | hypothetical protein | - |
| EL147_RS06855 | 1402161..1402400 | - | 240 | WP_007892248.1 | hypothetical protein | - |
| EL147_RS06860 | 1402624..1403253 | - | 630 | Protein_1274 | Rha family transcriptional regulator | - |
| EL147_RS06865 | 1403265..1403450 | - | 186 | WP_007892247.1 | hypothetical protein | - |
| EL147_RS06870 | 1403617..1404165 | + | 549 | WP_007892389.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1396390..1407776 | 11386 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10475.47 Da Isoelectric Point: 10.2939
>T287757 WP_007892295.1 NZ_LR134341:c1399160-1398891 [Streptococcus pseudoporcinus]
MTYKLVISDDVKKQLKKMDKYVALMLVKDMKKQLDNLNNPRQLGKALTGQYKGLWRYRIGNYRVICDIIDDELVTIAISI
GHRKDIYKK
MTYKLVISDDVKKQLKKMDKYVALMLVKDMKKQLDNLNNPRQLGKALTGQYKGLWRYRIGNYRVICDIIDDELVTIAISI
GHRKDIYKK
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|