Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1398891..1399377 Replicon chromosome
Accession NZ_LR134341
Organism Streptococcus pseudoporcinus strain NCTC13786

Toxin (Protein)


Gene name relE Uniprot ID G5K852
Locus tag EL147_RS06810 Protein ID WP_007892295.1
Coordinates 1398891..1399160 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G5K853
Locus tag EL147_RS06815 Protein ID WP_007892538.1
Coordinates 1399150..1399377 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL147_RS06795 1394689..1395291 - 603 WP_007892530.1 NAD(P)H-dependent oxidoreductase -
EL147_RS06800 1395472..1395831 + 360 WP_007892340.1 YbaN family protein -
EL147_RS06805 1396390..1397881 + 1492 Protein_1263 IS1182 family transposase -
EL147_RS06810 1398891..1399160 - 270 WP_007892295.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EL147_RS06815 1399150..1399377 - 228 WP_007892538.1 hypothetical protein Antitoxin
EL147_RS06820 1399562..1399864 - 303 WP_007892306.1 hypothetical protein -
EL147_RS06825 1399855..1400343 - 489 WP_176602242.1 hypothetical protein -
EL147_RS06830 1400408..1400671 - 264 WP_007892271.1 hypothetical protein -
EL147_RS06835 1400810..1401004 - 195 WP_007892513.1 DnaD domain protein -
EL147_RS06840 1400950..1401337 - 388 Protein_1270 phage replisome organizer N-terminal domain-containing protein -
EL147_RS06845 1401322..1401639 - 318 WP_007892369.1 hypothetical protein -
EL147_RS06850 1401641..1401973 - 333 WP_007892612.1 hypothetical protein -
EL147_RS06855 1402161..1402400 - 240 WP_007892248.1 hypothetical protein -
EL147_RS06860 1402624..1403253 - 630 Protein_1274 Rha family transcriptional regulator -
EL147_RS06865 1403265..1403450 - 186 WP_007892247.1 hypothetical protein -
EL147_RS06870 1403617..1404165 + 549 WP_007892389.1 helix-turn-helix transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1396390..1407776 11386


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10475.47 Da        Isoelectric Point: 10.2939

>T287757 WP_007892295.1 NZ_LR134341:c1399160-1398891 [Streptococcus pseudoporcinus]
MTYKLVISDDVKKQLKKMDKYVALMLVKDMKKQLDNLNNPRQLGKALTGQYKGLWRYRIGNYRVICDIIDDELVTIAISI
GHRKDIYKK

Download         Length: 270 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8781.90 Da        Isoelectric Point: 4.3992

>AT287757 WP_007892538.1 NZ_LR134341:c1399377-1399150 [Streptococcus pseudoporcinus]
MTTISLRLNEQEEKLFKSYSFHTGKTLSELFKTSLKEQIEDQLDYEEGIKALESFKKNPVTHSIDDIIMELENDL

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G5K852

Antitoxin

Source ID Structure
AlphaFold DB G5K853

References