Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2256738..2257376 | Replicon | chromosome |
| Accession | NZ_LR134340 | ||
| Organism | Escherichia marmotae strain NCTC11133 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | EL192_RS10805 | Protein ID | WP_016262026.1 |
| Coordinates | 2257200..2257376 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | EL192_RS10800 | Protein ID | WP_077627724.1 |
| Coordinates | 2256738..2257154 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL192_RS10780 | 2251893..2252834 | - | 942 | WP_001516417.1 | ABC transporter permease | - |
| EL192_RS10785 | 2252835..2253848 | - | 1014 | WP_016248715.1 | ABC transporter ATP-binding protein | - |
| EL192_RS10790 | 2253866..2255011 | - | 1146 | WP_000047463.1 | ABC transporter substrate-binding protein | - |
| EL192_RS10795 | 2255250..2256659 | - | 1410 | WP_016248716.1 | PLP-dependent aminotransferase family protein | - |
| EL192_RS10800 | 2256738..2257154 | - | 417 | WP_077627724.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| EL192_RS10805 | 2257200..2257376 | - | 177 | WP_016262026.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| EL192_RS10810 | 2257598..2257828 | + | 231 | WP_000494240.1 | DUF2554 family protein | - |
| EL192_RS10815 | 2257922..2259883 | - | 1962 | WP_024193578.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| EL192_RS10820 | 2259956..2260492 | - | 537 | WP_000429073.1 | XRE family transcriptional regulator | - |
| EL192_RS10825 | 2260545..2261756 | + | 1212 | WP_072024149.1 | benzoate/H(+) symporter BenE family transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6805.83 Da Isoelectric Point: 11.2292
>T287753 WP_016262026.1 NZ_LR134340:c2257376-2257200 [Escherichia marmotae]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLDLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLDLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15250.62 Da Isoelectric Point: 4.5908
>AT287753 WP_077627724.1 NZ_LR134340:c2257154-2256738 [Escherichia marmotae]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNNNDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNNNDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|