Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 5718404..5719057 | Replicon | chromosome |
Accession | NZ_LR134338 | ||
Organism | Brevibacillus brevis strain NCTC2611 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | J2PLP3 |
Locus tag | EL268_RS27730 | Protein ID | WP_005830205.1 |
Coordinates | 5718404..5718754 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | J2GZH3 |
Locus tag | EL268_RS27735 | Protein ID | WP_007721089.1 |
Coordinates | 5718758..5719057 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL268_RS27705 | 5715158..5715946 | - | 789 | WP_007721066.1 | RNA polymerase sigma factor SigB | - |
EL268_RS27710 | 5715915..5716409 | - | 495 | WP_106652694.1 | anti-sigma B factor RsbW | - |
EL268_RS27715 | 5716409..5716735 | - | 327 | WP_106652693.1 | anti-sigma factor antagonist | - |
EL268_RS27720 | 5716760..5717761 | - | 1002 | WP_106652692.1 | PP2C family protein-serine/threonine phosphatase | - |
EL268_RS27725 | 5717767..5718195 | - | 429 | WP_106652691.1 | anti-sigma regulatory factor | - |
EL268_RS27730 | 5718404..5718754 | - | 351 | WP_005830205.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL268_RS27735 | 5718758..5719057 | - | 300 | WP_007721089.1 | CopG family ribbon-helix-helix protein | Antitoxin |
EL268_RS27740 | 5719288..5720490 | - | 1203 | WP_106652690.1 | alanine racemase | - |
EL268_RS27745 | 5720493..5720933 | - | 441 | WP_106652689.1 | hypothetical protein | - |
EL268_RS27750 | 5721118..5722200 | - | 1083 | WP_106652688.1 | hypothetical protein | - |
EL268_RS27755 | 5722336..5722527 | + | 192 | WP_106652687.1 | hypothetical protein | - |
EL268_RS27760 | 5722904..5723941 | - | 1038 | WP_106652686.1 | outer membrane lipoprotein-sorting protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12917.86 Da Isoelectric Point: 4.8435
>T287743 WP_005830205.1 NZ_LR134338:c5718754-5718404 [Brevibacillus brevis]
VIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKTYGFDRDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVNESLQISLGLIDF
VIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKTYGFDRDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVNESLQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|