Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 465711..466282 Replicon chromosome
Accession NZ_LR134337
Organism Enterococcus faecium strain NCTC7174

Toxin (Protein)


Gene name mazF Uniprot ID Q3Y2B8
Locus tag EL154_RS02435 Protein ID WP_002286801.1
Coordinates 465941..466282 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A828ZZN9
Locus tag EL154_RS02430 Protein ID WP_002323011.1
Coordinates 465711..465941 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL154_RS02395 461191..462519 + 1329 WP_002327434.1 FAD-containing oxidoreductase -
EL154_RS02400 462541..463167 + 627 WP_002286816.1 cysteine hydrolase -
EL154_RS02405 463350..463931 + 582 WP_126331766.1 TetR/AcrR family transcriptional regulator -
EL154_RS02415 464296..464871 + 576 WP_002352505.1 SOS response-associated peptidase family protein -
EL154_RS02420 465077..465451 - 375 WP_158076077.1 hypothetical protein -
EL154_RS02430 465711..465941 + 231 WP_002323011.1 hypothetical protein Antitoxin
EL154_RS02435 465941..466282 + 342 WP_002286801.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EL154_RS02440 467132..467317 + 186 WP_002304207.1 hypothetical protein -
EL154_RS02445 467587..468749 + 1163 WP_086956687.1 IS3 family transposase -
EL154_RS12555 468997..469122 + 126 WP_025478972.1 LPXTG cell wall anchor domain-containing protein -
EL154_RS02455 469196..470092 + 897 WP_002352497.1 class C sortase -
EL154_RS02460 470273..470947 + 675 WP_002291233.1 response regulator transcription factor -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element ClpL ebpC 394890..609922 215032


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(10-113)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13302.68 Da        Isoelectric Point: 9.9044

>T287742 WP_002286801.1 NZ_LR134337:465941-466282 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8523.39 Da        Isoelectric Point: 3.9078

>AT287742 WP_002323011.1 NZ_LR134337:465711-465941 [Enterococcus faecium]
MLVTKSRLQGSSVVVTLPSDNGKKPSENQEYIVVYSDDGTITLVPKIEDPFSGGEEAEYYEKDEWEDLTPEGREIL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FD66

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZZN9

References