Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 254050..254651 | Replicon | chromosome |
Accession | NZ_LR134337 | ||
Organism | Enterococcus faecium strain NCTC7174 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A0V7YM55 |
Locus tag | EL154_RS01330 | Protein ID | WP_002330364.1 |
Coordinates | 254307..254651 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A6B3Q8V0 |
Locus tag | EL154_RS01325 | Protein ID | WP_002318881.1 |
Coordinates | 254050..254313 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL154_RS01295 | 249400..249702 | + | 303 | WP_002305086.1 | PTS sugar transporter subunit IIB | - |
EL154_RS01300 | 249721..251085 | + | 1365 | WP_002319286.1 | PTS sugar transporter subunit IIC | - |
EL154_RS01305 | 251141..251455 | + | 315 | WP_002305088.1 | PTS lactose/cellobiose transporter subunit IIA | - |
EL154_RS01310 | 251789..252835 | + | 1047 | Protein_248 | LacI family DNA-binding transcriptional regulator | - |
EL154_RS01320 | 253324..253863 | - | 540 | Protein_249 | IS30-like element IS6770 family transposase | - |
EL154_RS01325 | 254050..254313 | + | 264 | WP_002318881.1 | PbsX family transcriptional regulator | Antitoxin |
EL154_RS01330 | 254307..254651 | + | 345 | WP_002330364.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL154_RS01335 | 254786..255466 | - | 681 | WP_172594866.1 | IS6-like element IS1216 family transposase | - |
EL154_RS01340 | 255633..255842 | + | 210 | WP_082194338.1 | hypothetical protein | - |
EL154_RS01345 | 256049..256249 | + | 201 | Protein_254 | hypothetical protein | - |
EL154_RS01350 | 256735..256914 | + | 180 | WP_002340501.1 | hypothetical protein | - |
EL154_RS01355 | 256960..257295 | - | 336 | Protein_256 | recombinase family protein | - |
EL154_RS01360 | 257315..258356 | - | 1042 | Protein_257 | IS630 family transposase | - |
EL154_RS01365 | 258434..259422 | + | 989 | Protein_258 | IS3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 254050..270335 | 16285 | |
- | inside | IScluster/Tn | - | - | 253315..257803 | 4488 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13024.11 Da Isoelectric Point: 8.8971
>T287741 WP_002330364.1 NZ_LR134337:254307-254651 [Enterococcus faecium]
MVDVPRQGDILLLNTAPRSGHEQTGRRPYIVLSHDIIADTSNVVIVAPITTTSRNYPLYIEITENHKMKTRGKVMLDQIT
TIDYEARNCKFLEKASEKLIEELLTKIRAVFQKV
MVDVPRQGDILLLNTAPRSGHEQTGRRPYIVLSHDIIADTSNVVIVAPITTTSRNYPLYIEITENHKMKTRGKVMLDQIT
TIDYEARNCKFLEKASEKLIEELLTKIRAVFQKV
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V7YM55 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B3Q8V0 |