Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3532466..3533138 | Replicon | chromosome |
| Accession | NZ_LR134335 | ||
| Organism | Yersinia enterocolitica subsp. palearctica strain NCTC13769 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A7U7FIQ4 |
| Locus tag | EL202_RS16635 | Protein ID | WP_005166047.1 |
| Coordinates | 3532713..3533138 (+) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A7U7FJE4 |
| Locus tag | EL202_RS16630 | Protein ID | WP_004390965.1 |
| Coordinates | 3532466..3532732 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL202_RS16610 | 3528064..3528666 | - | 603 | WP_005164134.1 | HD domain-containing protein | - |
| EL202_RS16615 | 3528897..3529580 | + | 684 | WP_005180855.1 | hemolysin III family protein | - |
| EL202_RS16620 | 3529992..3531011 | - | 1020 | WP_129546912.1 | IS110 family transposase | - |
| EL202_RS16625 | 3531207..3532199 | - | 993 | WP_005166051.1 | tRNA-modifying protein YgfZ | - |
| EL202_RS16630 | 3532466..3532732 | + | 267 | WP_004390965.1 | FAD assembly factor SdhE | Antitoxin |
| EL202_RS16635 | 3532713..3533138 | + | 426 | WP_005166047.1 | protein YgfX | Toxin |
| EL202_RS16640 | 3533138..3533836 | + | 699 | WP_005166045.1 | two-component system response regulator CreB | - |
| EL202_RS16645 | 3533847..3535269 | + | 1423 | Protein_3130 | two-component system sensor histidine kinase CreC | - |
| EL202_RS16650 | 3535361..3536782 | + | 1422 | WP_005166043.1 | cell envelope integrity protein CreD | - |
| EL202_RS16655 | 3536841..3537359 | - | 519 | WP_005166042.1 | flavodoxin FldB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 3529992..3531011 | 1019 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 16425.21 Da Isoelectric Point: 9.8217
>T287737 WP_005166047.1 NZ_LR134335:3532713-3533138 [Yersinia enterocolitica subsp. palearctica]
VAQWRCDLRISWHTQLFSLLAHGVLVTLTLVAPWPQGYTALWLVLLTLVVFECIRSQKNITSCQGEIRLKPGNIVLWKRH
EWVVIKQPWITRYGVLLSLQQTSSRSTRKRLWLAADSMSEEEWRQLCLLLRHSFGSDEGIN
VAQWRCDLRISWHTQLFSLLAHGVLVTLTLVAPWPQGYTALWLVLLTLVVFECIRSQKNITSCQGEIRLKPGNIVLWKRH
EWVVIKQPWITRYGVLLSLQQTSSRSTRKRLWLAADSMSEEEWRQLCLLLRHSFGSDEGIN
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U7FIQ4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U7FJE4 |