Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 6577286..6577871 | Replicon | chromosome |
Accession | NZ_LR134334 | ||
Organism | Pseudomonas chlororaphis strain NCTC7357 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A3G7C0N8 |
Locus tag | EL332_RS29560 | Protein ID | WP_025804099.1 |
Coordinates | 6577578..6577871 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A3G7CJP2 |
Locus tag | EL332_RS29555 | Protein ID | WP_025804100.1 |
Coordinates | 6577286..6577576 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL332_RS29540 | 6572611..6575091 | + | 2481 | WP_124325843.1 | FtsX-like permease family protein | - |
EL332_RS29545 | 6575081..6576157 | + | 1077 | WP_124323951.1 | iron ABC transporter permease | - |
EL332_RS29550 | 6576285..6576872 | + | 588 | WP_063429489.1 | hypothetical protein | - |
EL332_RS29555 | 6577286..6577576 | - | 291 | WP_025804100.1 | putative addiction module antidote protein | Antitoxin |
EL332_RS29560 | 6577578..6577871 | - | 294 | WP_025804099.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL332_RS29565 | 6578107..6579501 | - | 1395 | WP_124323952.1 | VOC family protein | - |
EL332_RS29570 | 6579764..6580888 | + | 1125 | WP_124323953.1 | diguanylate cyclase | - |
EL332_RS29575 | 6580982..6582226 | + | 1245 | WP_124323954.1 | M20/M25/M40 family metallo-hydrolase | - |
EL332_RS29580 | 6582439..6582837 | + | 399 | WP_016702749.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10837.49 Da Isoelectric Point: 10.7289
>T287723 WP_025804099.1 NZ_LR134334:c6577871-6577578 [Pseudomonas chlororaphis]
MEYEILQTTVFAQWHTRLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNRGAGYRIYFTVRGNTLIVLLLGGDK
STQPADICQARSLAKEF
MEYEILQTTVFAQWHTRLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNRGAGYRIYFTVRGNTLIVLLLGGDK
STQPADICQARSLAKEF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G7C0N8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G7CJP2 |