Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 6562615..6563234 | Replicon | chromosome |
Accession | NZ_LR134334 | ||
Organism | Pseudomonas chlororaphis strain NCTC7357 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A3G7DMG3 |
Locus tag | EL332_RS29500 | Protein ID | WP_009048155.1 |
Coordinates | 6563052..6563234 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A285IZU0 |
Locus tag | EL332_RS29495 | Protein ID | WP_007923747.1 |
Coordinates | 6562615..6563016 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL332_RS29480 | 6558685..6560574 | + | 1890 | WP_124304744.1 | PAS domain S-box protein | - |
EL332_RS29485 | 6560571..6561206 | + | 636 | WP_124304745.1 | response regulator transcription factor | - |
EL332_RS29490 | 6561300..6562049 | + | 750 | WP_124304746.1 | hypothetical protein | - |
EL332_RS29495 | 6562615..6563016 | - | 402 | WP_007923747.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
EL332_RS29500 | 6563052..6563234 | - | 183 | WP_009048155.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
EL332_RS29505 | 6563526..6563807 | - | 282 | WP_124304747.1 | hypothetical protein | - |
EL332_RS29510 | 6564451..6566610 | - | 2160 | WP_164486009.1 | AAA family ATPase | - |
EL332_RS29515 | 6566951..6567499 | - | 549 | WP_124304749.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6799.98 Da Isoelectric Point: 10.9678
>T287722 WP_009048155.1 NZ_LR134334:c6563234-6563052 [Pseudomonas chlororaphis]
VQSRQLIKELEAAGWVLERVTGSHHLFKHPYRPETVPVPHPKKDLPRGTVRAIQKLAGLI
VQSRQLIKELEAAGWVLERVTGSHHLFKHPYRPETVPVPHPKKDLPRGTVRAIQKLAGLI
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14579.54 Da Isoelectric Point: 4.6017
>AT287722 WP_007923747.1 NZ_LR134334:c6563016-6562615 [Pseudomonas chlororaphis]
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQAIPLPSPTGTHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQAIPLPSPTGTHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G7DMG3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A285IZU0 |