Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 4493364..4493977 | Replicon | chromosome |
| Accession | NZ_LR134334 | ||
| Organism | Pseudomonas chlororaphis strain NCTC7357 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A285EYZ4 |
| Locus tag | EL332_RS20005 | Protein ID | WP_009041685.1 |
| Coordinates | 4493364..4493546 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | EL332_RS20010 | Protein ID | WP_025808441.1 |
| Coordinates | 4493576..4493977 (+) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL332_RS19980 | 4488538..4490502 | + | 1965 | WP_164486059.1 | choline transporter BetT | - |
| EL332_RS19985 | 4490623..4490880 | - | 258 | WP_025808445.1 | hypothetical protein | - |
| EL332_RS19990 | 4490934..4491422 | - | 489 | WP_124323274.1 | DoxX family membrane protein | - |
| EL332_RS19995 | 4491479..4492219 | - | 741 | WP_124323275.1 | SDR family oxidoreductase | - |
| EL332_RS20000 | 4492349..4493239 | + | 891 | WP_124323276.1 | LysR family transcriptional regulator | - |
| EL332_RS20005 | 4493364..4493546 | + | 183 | WP_009041685.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| EL332_RS20010 | 4493576..4493977 | + | 402 | WP_025808441.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| EL332_RS20015 | 4494568..4495605 | + | 1038 | WP_124323277.1 | L-glyceraldehyde 3-phosphate reductase | - |
| EL332_RS20020 | 4495735..4496163 | - | 429 | WP_124323278.1 | type II toxin-antitoxin system VapC family toxin | - |
| EL332_RS20025 | 4496160..4496405 | - | 246 | WP_009046453.1 | plasmid stabilization protein | - |
| EL332_RS20030 | 4496545..4497384 | - | 840 | WP_124323279.1 | taurine dioxygenase | - |
| EL332_RS20035 | 4497622..4498461 | - | 840 | WP_124323280.1 | taurine ABC transporter permease TauC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6933.08 Da Isoelectric Point: 10.4588
>T287718 WP_009041685.1 NZ_LR134334:4493364-4493546 [Pseudomonas chlororaphis]
MRSRELIRMIEEDGWYLIAVKGSHHQYKHLHKPGRVTIPHPDADLPRGTIHSILKQAGLK
MRSRELIRMIEEDGWYLIAVKGSHHQYKHLHKPGRVTIPHPDADLPRGTIHSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14568.38 Da Isoelectric Point: 4.9036
>AT287718 WP_025808441.1 NZ_LR134334:4493576-4493977 [Pseudomonas chlororaphis]
MKFPVVLHKDADSGYGVIVPDVPGCFSAGHTAAQAFENVKEALSLHYEGLVADGEPLPQVHEVDVHIDNPDYAGGVWGVV
DFDITPYFGKAVRFNATLPEQLLERIDQTVKRDQRYRSRSGFLAAAALRELSA
MKFPVVLHKDADSGYGVIVPDVPGCFSAGHTAAQAFENVKEALSLHYEGLVADGEPLPQVHEVDVHIDNPDYAGGVWGVV
DFDITPYFGKAVRFNATLPEQLLERIDQTVKRDQRYRSRSGFLAAAALRELSA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|