Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 5456344..5457047 | Replicon | chromosome |
Accession | NZ_LR134333 | ||
Organism | Klebsiella oxytoca strain NCTC13727 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | EL226_RS25850 | Protein ID | WP_064406970.1 |
Coordinates | 5456344..5456685 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | EL226_RS25855 | Protein ID | WP_073971812.1 |
Coordinates | 5456706..5457047 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL226_RS25825 | 5451963..5452757 | + | 795 | WP_053064564.1 | DNA/RNA non-specific endonuclease | - |
EL226_RS25830 | 5453047..5453370 | + | 324 | WP_049102104.1 | endoribonuclease SymE | - |
EL226_RS25835 | 5453517..5453951 | + | 435 | WP_032728836.1 | VOC family protein | - |
EL226_RS25840 | 5454105..5454848 | + | 744 | WP_049102101.1 | hypothetical protein | - |
EL226_RS25845 | 5455078..5456085 | - | 1008 | WP_064406969.1 | restriction endonuclease | - |
EL226_RS25850 | 5456344..5456685 | - | 342 | WP_064406970.1 | TA system toxin CbtA family protein | Toxin |
EL226_RS25855 | 5456706..5457047 | - | 342 | WP_073971812.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
EL226_RS25860 | 5457058..5457600 | - | 543 | WP_064406972.1 | DNA repair protein RadC | - |
EL226_RS25865 | 5457613..5458056 | - | 444 | WP_064406973.1 | antirestriction protein | - |
EL226_RS25870 | 5458087..5458908 | - | 822 | WP_064406974.1 | DUF945 domain-containing protein | - |
EL226_RS25875 | 5459029..5459502 | - | 474 | WP_064406975.1 | hypothetical protein | - |
EL226_RS25880 | 5459550..5460002 | - | 453 | WP_064406976.1 | hypothetical protein | - |
EL226_RS25885 | 5460038..5460754 | - | 717 | WP_064406977.1 | WYL domain-containing protein | - |
EL226_RS25890 | 5460998..5461873 | - | 876 | WP_064406978.1 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 5453517..5470755 | 17238 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12700.63 Da Isoelectric Point: 8.9919
>T287716 WP_064406970.1 NZ_LR134333:c5456685-5456344 [Klebsiella oxytoca]
MKTLPATNPQAATLCLPPVAGWQMLLARLLEQHYGLTLNDTPFSDEKVIQEHIDAGISLADAANFLVEKYGLVRIDRRGF
DWQEQSPYLRAVDILRARQATGLLKRNRISAAR
MKTLPATNPQAATLCLPPVAGWQMLLARLLEQHYGLTLNDTPFSDEKVIQEHIDAGISLADAANFLVEKYGLVRIDRRGF
DWQEQSPYLRAVDILRARQATGLLKRNRISAAR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|