Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4672393..4673012 | Replicon | chromosome |
Accession | NZ_LR134333 | ||
Organism | Klebsiella oxytoca strain NCTC13727 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H3N9D8 |
Locus tag | EL226_RS22250 | Protein ID | WP_004099646.1 |
Coordinates | 4672794..4673012 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | EL226_RS22245 | Protein ID | WP_004099648.1 |
Coordinates | 4672393..4672767 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL226_RS22235 | 4667549..4668742 | + | 1194 | WP_004111040.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
EL226_RS22240 | 4668765..4671911 | + | 3147 | WP_004099650.1 | multidrug efflux RND transporter permease subunit | - |
EL226_RS22245 | 4672393..4672767 | + | 375 | WP_004099648.1 | Hha toxicity modulator TomB | Antitoxin |
EL226_RS22250 | 4672794..4673012 | + | 219 | WP_004099646.1 | hemolysin expression modulator Hha | Toxin |
EL226_RS22255 | 4673173..4673739 | + | 567 | WP_004099644.1 | maltose O-acetyltransferase | - |
EL226_RS22260 | 4673876..4674346 | + | 471 | WP_004111038.1 | YlaC family protein | - |
EL226_RS22265 | 4674321..4675775 | - | 1455 | WP_024273853.1 | PLP-dependent aminotransferase family protein | - |
EL226_RS22270 | 4675878..4676576 | + | 699 | WP_004099639.1 | GNAT family N-acetyltransferase | - |
EL226_RS22275 | 4676573..4676713 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
EL226_RS22280 | 4676713..4676976 | - | 264 | WP_004099638.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T287714 WP_004099646.1 NZ_LR134333:4672794-4673012 [Klebsiella oxytoca]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14350.09 Da Isoelectric Point: 4.8989
>AT287714 WP_004099648.1 NZ_LR134333:4672393-4672767 [Klebsiella oxytoca]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|