Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1188300..1188957 | Replicon | chromosome |
| Accession | NZ_LR134333 | ||
| Organism | Klebsiella oxytoca strain NCTC13727 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A181X6I0 |
| Locus tag | EL226_RS05770 | Protein ID | WP_004105559.1 |
| Coordinates | 1188547..1188957 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A285B945 |
| Locus tag | EL226_RS05765 | Protein ID | WP_004105561.1 |
| Coordinates | 1188300..1188566 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL226_RS05740 | 1183480..1184913 | - | 1434 | WP_004105576.1 | 6-phospho-beta-glucosidase | - |
| EL226_RS05745 | 1185034..1185762 | - | 729 | WP_064352017.1 | MurR/RpiR family transcriptional regulator | - |
| EL226_RS05750 | 1185813..1186124 | + | 312 | WP_017145456.1 | N(4)-acetylcytidine aminohydrolase | - |
| EL226_RS05755 | 1186286..1186945 | + | 660 | WP_004105569.1 | hemolysin III family protein | - |
| EL226_RS05760 | 1187073..1188056 | - | 984 | WP_004115279.1 | tRNA-modifying protein YgfZ | - |
| EL226_RS05765 | 1188300..1188566 | + | 267 | WP_004105561.1 | FAD assembly factor SdhE | Antitoxin |
| EL226_RS05770 | 1188547..1188957 | + | 411 | WP_004105559.1 | protein YgfX | Toxin |
| EL226_RS05775 | 1188966..1189487 | - | 522 | WP_004105557.1 | flavodoxin FldB | - |
| EL226_RS05780 | 1189609..1190505 | + | 897 | WP_004105555.1 | site-specific tyrosine recombinase XerD | - |
| EL226_RS05785 | 1190528..1191241 | + | 714 | WP_064406949.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| EL226_RS05790 | 1191247..1192980 | + | 1734 | WP_004105553.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16061.83 Da Isoelectric Point: 10.9455
>T287709 WP_004105559.1 NZ_LR134333:1188547-1188957 [Klebsiella oxytoca]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A181X6I0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A285B945 |