Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2500048..2500610 | Replicon | chromosome |
Accession | NZ_LR134331 | ||
Organism | Lacticaseibacillus rhamnosus strain NCTC13764 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | C2JYM4 |
Locus tag | EL173_RS12540 | Protein ID | WP_005692155.1 |
Coordinates | 2500048..2500395 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | EL173_RS12545 | Protein ID | WP_014571589.1 |
Coordinates | 2500395..2500610 (-) | Length | 72 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL173_RS12510 | 2495543..2496784 | - | 1242 | WP_005692160.1 | acyltransferase | - |
EL173_RS12515 | 2496781..2497482 | - | 702 | WP_005692159.1 | ABC transporter ATP-binding protein | - |
EL173_RS12520 | 2497475..2498293 | - | 819 | WP_014571588.1 | ABC transporter permease subunit | - |
EL173_RS12525 | 2498534..2499202 | - | 669 | WP_005692157.1 | tRNA ligase | - |
EL173_RS12530 | 2499382..2499525 | + | 144 | WP_015764720.1 | hypothetical protein | - |
EL173_RS12540 | 2500048..2500395 | - | 348 | WP_005692155.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL173_RS12545 | 2500395..2500610 | - | 216 | WP_014571589.1 | hypothetical protein | Antitoxin |
EL173_RS12550 | 2500707..2502542 | - | 1836 | WP_015764721.1 | ABC transporter ATP-binding protein/permease | - |
EL173_RS12555 | 2502529..2504319 | - | 1791 | WP_015764722.1 | ABC transporter ATP-binding protein/permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13150.01 Da Isoelectric Point: 7.9817
>T287705 WP_005692155.1 NZ_LR134331:c2500395-2500048 [Lacticaseibacillus rhamnosus]
MTYKAKQGDVVWLDFDPSEGHEIRKRCPAVVLSSNAYNRATGFVIVAPITSTIRTLPGYVDIVSNKIRGQVVTSQVYSLD
VTEQGNRKIDFIERMNIEDFYTVAQFTKMNFDFKF
MTYKAKQGDVVWLDFDPSEGHEIRKRCPAVVLSSNAYNRATGFVIVAPITSTIRTLPGYVDIVSNKIRGQVVTSQVYSLD
VTEQGNRKIDFIERMNIEDFYTVAQFTKMNFDFKF
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|