Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 2002233..2002738 | Replicon | chromosome |
Accession | NZ_LR134330 | ||
Organism | Pseudomonas aeruginosa strain NCTC13715 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | EL342_RS09445 | Protein ID | WP_003083773.1 |
Coordinates | 2002233..2002514 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | EL342_RS09450 | Protein ID | WP_003083775.1 |
Coordinates | 2002511..2002738 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL342_RS09420 | 1997484..1998833 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
EL342_RS09425 | 1998882..1999568 | + | 687 | WP_003083762.1 | FadR family transcriptional regulator | - |
EL342_RS09430 | 1999669..2000403 | + | 735 | WP_003110658.1 | GntR family transcriptional regulator | - |
EL342_RS09435 | 2000607..2000993 | + | 387 | WP_003083767.1 | aegerolysin family protein | - |
EL342_RS09440 | 2001025..2001933 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
EL342_RS09445 | 2002233..2002514 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
EL342_RS09450 | 2002511..2002738 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
EL342_RS09455 | 2002914..2003534 | - | 621 | WP_003101226.1 | hypothetical protein | - |
EL342_RS09460 | 2003635..2004135 | + | 501 | WP_003162763.1 | LEA type 2 family protein | - |
EL342_RS09465 | 2004208..2004549 | + | 342 | WP_003101229.1 | alkylphosphonate utilization protein | - |
EL342_RS09470 | 2004631..2006058 | - | 1428 | WP_003083784.1 | GABA permease | - |
EL342_RS09475 | 2006227..2007720 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T287699 WP_003083773.1 NZ_LR134330:c2002514-2002233 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|