Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 4444156..4444792 | Replicon | chromosome |
Accession | NZ_LR134329 | ||
Organism | Bordetella parapertussis strain NCTC10524 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | Q7W5Z1 |
Locus tag | EL261_RS21015 | Protein ID | WP_010928914.1 |
Coordinates | 4444156..4444338 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | Q7W5Z0 |
Locus tag | EL261_RS21020 | Protein ID | WP_010928915.1 |
Coordinates | 4444400..4444792 (+) | Length | 131 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL261_RS20990 | 4439730..4440407 | + | 678 | WP_010928910.1 | HAD-IA family hydrolase | - |
EL261_RS20995 | 4440625..4441812 | + | 1188 | WP_010928911.1 | MFS transporter | - |
EL261_RS21005 | 4442387..4443607 | + | 1221 | WP_010928912.1 | ISL3-like element IS1001 family transposase | - |
EL261_RS21015 | 4444156..4444338 | + | 183 | WP_010928914.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
EL261_RS21020 | 4444400..4444792 | + | 393 | WP_010928915.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
EL261_RS21025 | 4445065..4445974 | - | 910 | Protein_4123 | LysR family transcriptional regulator | - |
EL261_RS21030 | 4446099..4447073 | + | 975 | WP_010928916.1 | tripartite tricarboxylate transporter substrate binding protein | - |
EL261_RS21035 | 4447108..4447467 | + | 360 | WP_010928917.1 | hypothetical protein | - |
EL261_RS21040 | 4447534..4448706 | + | 1173 | WP_010928918.1 | thiolase domain-containing protein | - |
EL261_RS21045 | 4448710..4449136 | + | 427 | Protein_4127 | OB-fold domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 4442387..4443607 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6572.69 Da Isoelectric Point: 10.9062
>T287697 WP_010928914.1 NZ_LR134329:4444156-4444338 [Bordetella parapertussis]
MDGKELIKQLERSGWTLRSVKGSHHVFAHPDRPGHISVPHPKKDLGIGLLNSILKAAGLK
MDGKELIKQLERSGWTLRSVKGSHHVFAHPDRPGHISVPHPKKDLGIGLLNSILKAAGLK
Download Length: 183 bp
Antitoxin
Download Length: 131 a.a. Molecular weight: 14058.82 Da Isoelectric Point: 4.2876
>AT287697 WP_010928915.1 NZ_LR134329:4444400-4444792 [Bordetella parapertussis]
VKYPIAIEPGSDTRAWGVVVPDLPGCFSAADEGIDQAIENAKEAIELWIETAIDSGAPIPAATNIANHQANPEFANWIWA
IADVDPAVLDETVERVNITIPRRILKRLDDRARAAGESRSSYIAHLAMTA
VKYPIAIEPGSDTRAWGVVVPDLPGCFSAADEGIDQAIENAKEAIELWIETAIDSGAPIPAATNIANHQANPEFANWIWA
IADVDPAVLDETVERVNITIPRRILKRLDDRARAAGESRSSYIAHLAMTA
Download Length: 393 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|