Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 3288134..3288728 Replicon chromosome
Accession NZ_LR134329
Organism Bordetella parapertussis strain NCTC10524

Toxin (Protein)


Gene name hicA Uniprot ID K0M8J0
Locus tag EL261_RS15645 Protein ID WP_010928352.1
Coordinates 3288546..3288728 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID K0MFV7
Locus tag EL261_RS15640 Protein ID WP_010928351.1
Coordinates 3288134..3288523 (-) Length 130 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL261_RS15615 3283977..3285017 + 1041 WP_003809635.1 phosphate ABC transporter substrate-binding protein PstS -
EL261_RS15620 3285152..3286168 + 1017 WP_010928350.1 phosphate ABC transporter permease subunit PstC -
EL261_RS15625 3286190..3287047 + 858 WP_003809638.1 phosphate ABC transporter permease PstA -
EL261_RS15630 3287092..3287868 + 777 WP_033448479.1 phosphate ABC transporter ATP-binding protein PstB -
EL261_RS15640 3288134..3288523 - 390 WP_010928351.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
EL261_RS15645 3288546..3288728 - 183 WP_010928352.1 type II toxin-antitoxin system HicA family toxin Toxin
EL261_RS15650 3289136..3289834 + 699 WP_003809653.1 gluconate 2-dehydrogenase subunit 3 family protein -
EL261_RS15655 3289838..3291607 + 1770 WP_010928353.1 GMC family oxidoreductase -
EL261_RS15660 3291618..3292973 + 1356 WP_003809657.1 cytochrome c -
EL261_RS15665 3292985..3293725 - 741 WP_003809659.1 carbonic anhydrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-122)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6750.76 Da        Isoelectric Point: 11.4018

>T287695 WP_010928352.1 NZ_LR134329:c3288728-3288546 [Bordetella parapertussis]
MNSTDLIQQPKADGWYRVHTVGSHHQYKHPTKPGKVTVPHPRKGLPTATQRSILKQAGLR

Download         Length: 183 bp

Antitoxin


Download         Length: 130 a.a.        Molecular weight: 14270.92 Da        Isoelectric Point: 4.3014

>AT287695 WP_010928351.1 NZ_LR134329:c3288523-3288134 [Bordetella parapertussis]
MLYPIHVSKDEGSAYGAAFPDFPGCFAAADELQDLPRAAQEAVEAHFYGETERIPAPSAPEAWANDEDYQGGYWMMVDID
LSKVNTKAVRLNISLPENLVHRIDEEAKARRLSRSAFLAMAAEHEMADA

Download         Length: 390 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB K0M8J0

Antitoxin

Source ID Structure
AlphaFold DB K0MFV7

References