Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpA-brnA/BrnT_toxin-BrnA |
| Location | 3153957..3154488 | Replicon | chromosome |
| Accession | NZ_LR134329 | ||
| Organism | Bordetella parapertussis strain NCTC10524 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | K0MH61 |
| Locus tag | EL261_RS15010 | Protein ID | WP_003812626.1 |
| Coordinates | 3154222..3154488 (-) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | brnA | Uniprot ID | K0MF02 |
| Locus tag | EL261_RS15005 | Protein ID | WP_003816743.1 |
| Coordinates | 3153957..3154235 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL261_RS14980 | 3149387..3150481 | + | 1095 | WP_003812637.1 | TRAP transporter substrate-binding protein | - |
| EL261_RS14985 | 3150693..3151322 | + | 630 | WP_010928293.1 | TRAP transporter small permease subunit | - |
| EL261_RS14990 | 3151325..3152992 | + | 1668 | WP_010928294.1 | TRAP transporter large permease subunit | - |
| EL261_RS14995 | 3153007..3153663 | + | 657 | WP_010928295.1 | phosphoribosylanthranilate isomerase | - |
| EL261_RS15005 | 3153957..3154235 | - | 279 | WP_003816743.1 | BrnA antitoxin family protein | Antitoxin |
| EL261_RS15010 | 3154222..3154488 | - | 267 | WP_003812626.1 | BrnT family toxin | Toxin |
| EL261_RS15015 | 3154719..3156260 | - | 1542 | WP_010928296.1 | M81 family metallopeptidase | - |
| EL261_RS15020 | 3156322..3157200 | - | 879 | WP_041937387.1 | tripartite tricarboxylate transporter substrate binding protein | - |
| EL261_RS15025 | 3157597..3158229 | + | 633 | WP_003812619.1 | PAS domain-containing protein | - |
| EL261_RS15030 | 3158340..3159050 | + | 711 | WP_003812617.1 | aquaporin Z | - |
| EL261_RS15035 | 3159089..3159361 | - | 273 | WP_003812615.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10037.47 Da Isoelectric Point: 7.9923
>T287694 WP_003812626.1 NZ_LR134329:c3154488-3154222 [Bordetella parapertussis]
MDITYDPAKNDKNIADRGLSFELVCGFEWASALVVEDTRQVYAETRYQALGKIDGRLHMVVFTVRGESLRIISLRKANAR
EVARYEKA
MDITYDPAKNDKNIADRGLSFELVCGFEWASALVVEDTRQVYAETRYQALGKIDGRLHMVVFTVRGESLRIISLRKANAR
EVARYEKA
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|