Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 2248300..2248961 | Replicon | chromosome |
| Accession | NZ_LR134326 | ||
| Organism | Bordetella bronchiseptica strain NCTC10543 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q7WAH5 |
| Locus tag | EL288_RS10460 | Protein ID | WP_003812073.1 |
| Coordinates | 2248300..2248725 (-) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | EL288_RS10465 | Protein ID | WP_003812071.1 |
| Coordinates | 2248722..2248961 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL288_RS10440 | 2244114..2245091 | + | 978 | WP_003812083.1 | tripartite tricarboxylate transporter substrate binding protein | - |
| EL288_RS10445 | 2245112..2245624 | - | 513 | WP_003812080.1 | hypothetical protein | - |
| EL288_RS10450 | 2246123..2247628 | + | 1506 | WP_003812078.1 | tripartite tricarboxylate transporter permease | - |
| EL288_RS10455 | 2247726..2248190 | - | 465 | WP_003812075.1 | MarR family transcriptional regulator | - |
| EL288_RS10460 | 2248300..2248725 | - | 426 | WP_003812073.1 | PIN domain-containing protein | Toxin |
| EL288_RS10465 | 2248722..2248961 | - | 240 | WP_003812071.1 | Arc family DNA-binding protein | Antitoxin |
| EL288_RS10470 | 2249035..2249877 | - | 843 | WP_126622041.1 | AraC family transcriptional regulator | - |
| EL288_RS10475 | 2250015..2250560 | + | 546 | WP_003812065.1 | peroxidase-related enzyme | - |
| EL288_RS10480 | 2250619..2251131 | + | 513 | WP_003812062.1 | redoxin domain-containing protein | - |
| EL288_RS10485 | 2251212..2251445 | + | 234 | WP_033447224.1 | DUF2945 domain-containing protein | - |
| EL288_RS10490 | 2251442..2252002 | + | 561 | WP_010926528.1 | DUF488 domain-containing protein | - |
| EL288_RS10495 | 2252080..2253126 | + | 1047 | WP_003812057.1 | Dyp-type peroxidase | - |
| EL288_RS10500 | 2253123..2253926 | + | 804 | WP_003812055.1 | bacteriocin family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 14811.22 Da Isoelectric Point: 6.3704
>T287688 WP_003812073.1 NZ_LR134326:c2248725-2248300 [Bordetella bronchiseptica]
MILLDTDVLLEPLRPAPDPAVAAWLDAQHVETLYLAAPGAAEIQLGLARLPRGKRAEALRHEFERRVLPLFMGHVLPFDT
AAADAYAAVMMRAAAAGHALCAIDGCIAAIATAHGLAIATRHPARFEAAGLAAVDPWHAAA
MILLDTDVLLEPLRPAPDPAVAAWLDAQHVETLYLAAPGAAEIQLGLARLPRGKRAEALRHEFERRVLPLFMGHVLPFDT
AAADAYAAVMMRAAAAGHALCAIDGCIAAIATAHGLAIATRHPARFEAAGLAAVDPWHAAA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|