Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpA-brnA/BrnT_toxin-BrnA |
Location | 1946069..1946600 | Replicon | chromosome |
Accession | NZ_LR134326 | ||
Organism | Bordetella bronchiseptica strain NCTC10543 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | A0A0C6P1L1 |
Locus tag | EL288_RS09080 | Protein ID | WP_015064047.1 |
Coordinates | 1946334..1946600 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | K0MF02 |
Locus tag | EL288_RS09075 | Protein ID | WP_003816743.1 |
Coordinates | 1946069..1946347 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL288_RS09050 | 1941499..1942593 | + | 1095 | WP_003812637.1 | TRAP transporter substrate-binding protein | - |
EL288_RS09055 | 1942805..1943434 | + | 630 | WP_033451894.1 | TRAP transporter small permease subunit | - |
EL288_RS09060 | 1943437..1945104 | + | 1668 | WP_003812634.1 | TRAP transporter large permease subunit | - |
EL288_RS09065 | 1945119..1945775 | + | 657 | WP_003812630.1 | phosphoribosylanthranilate isomerase | - |
EL288_RS09075 | 1946069..1946347 | - | 279 | WP_003816743.1 | BrnA antitoxin family protein | Antitoxin |
EL288_RS09080 | 1946334..1946600 | - | 267 | WP_015064047.1 | BrnT family toxin | Toxin |
EL288_RS09085 | 1946831..1948372 | - | 1542 | WP_003812624.1 | M81 family metallopeptidase | - |
EL288_RS09090 | 1948434..1949312 | - | 879 | WP_003812621.1 | tripartite tricarboxylate transporter substrate binding protein | - |
EL288_RS09095 | 1949709..1950341 | + | 633 | WP_003812619.1 | PAS domain-containing protein | - |
EL288_RS09100 | 1950452..1951162 | + | 711 | WP_003812617.1 | aquaporin Z | - |
EL288_RS09105 | 1951201..1951473 | - | 273 | WP_003812615.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10090.52 Da Isoelectric Point: 9.4798
>T287685 WP_015064047.1 NZ_LR134326:c1946600-1946334 [Bordetella bronchiseptica]
MDITYDPAKNDKNIADRGLSFELVRGFEWASALVVEDTRQVYAETRYQALGKIDGRLHMVVFTVRGESLRIISLRKANAR
EVARYEKA
MDITYDPAKNDKNIADRGLSFELVRGFEWASALVVEDTRQVYAETRYQALGKIDGRLHMVVFTVRGESLRIISLRKANAR
EVARYEKA
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0C6P1L1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | K0MF02 |