Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1745236..1745848 | Replicon | chromosome |
Accession | NZ_LR134323 | ||
Organism | Streptococcus urinalis strain NCTC13766 |
Toxin (Protein)
Gene name | parE | Uniprot ID | G5KDE2 |
Locus tag | EL133_RS08955 | Protein ID | WP_006739169.1 |
Coordinates | 1745513..1745848 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | G5KDE1 |
Locus tag | EL133_RS08950 | Protein ID | WP_006738697.1 |
Coordinates | 1745236..1745523 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL133_RS08925 | 1740525..1741505 | - | 981 | WP_006739323.1 | C-terminal binding protein | - |
EL133_RS08930 | 1741516..1741956 | - | 441 | WP_006739919.1 | hypothetical protein | - |
EL133_RS08935 | 1741953..1743311 | - | 1359 | WP_006739787.1 | PTS transporter subunit EIIC | - |
EL133_RS08940 | 1743646..1744488 | - | 843 | WP_006740372.1 | MurR/RpiR family transcriptional regulator | - |
EL133_RS08945 | 1744942..1745025 | - | 84 | Protein_1759 | 30S ribosomal protein S9 | - |
EL133_RS08950 | 1745236..1745523 | + | 288 | WP_006738697.1 | hypothetical protein | Antitoxin |
EL133_RS08955 | 1745513..1745848 | + | 336 | WP_006739169.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL133_RS08960 | 1746153..1746623 | - | 471 | WP_006739650.1 | hypothetical protein | - |
EL133_RS08965 | 1746791..1748047 | - | 1257 | Protein_1763 | plasmid recombination protein | - |
EL133_RS08970 | 1748364..1748798 | - | 435 | WP_006739931.1 | hypothetical protein | - |
EL133_RS08975 | 1748834..1748941 | - | 108 | Protein_1765 | replication initiation protein | - |
EL133_RS08990 | 1749271..1749599 | - | 329 | Protein_1766 | hypothetical protein | - |
EL133_RS09000 | 1749810..1750148 | - | 339 | WP_006739797.1 | Cd(II)/Zn(II)-sensing metalloregulatory transcriptional regulator CadX | - |
EL133_RS09005 | 1750160..1750786 | - | 627 | WP_196792586.1 | CadD family cadmium resistance transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13296.00 Da Isoelectric Point: 4.7846
>T287683 WP_006739169.1 NZ_LR134323:1745513-1745848 [Streptococcus urinalis]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKN
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKN
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|