Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 2599626..2600277 | Replicon | chromosome |
Accession | NZ_LR134322 | ||
Organism | Lacticaseibacillus rhamnosus strain NCTC13710 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | K8Q4Y0 |
Locus tag | EL156_RS13070 | Protein ID | WP_005686631.1 |
Coordinates | 2599626..2600009 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | K8QH19 |
Locus tag | EL156_RS13075 | Protein ID | WP_005686632.1 |
Coordinates | 2600029..2600277 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL156_RS13055 | 2598585..2599112 | - | 528 | WP_005691221.1 | QueT transporter family protein | - |
EL156_RS13070 | 2599626..2600009 | - | 384 | WP_005686631.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL156_RS13075 | 2600029..2600277 | - | 249 | WP_005686632.1 | antitoxin | Antitoxin |
EL156_RS13080 | 2600389..2601528 | - | 1140 | WP_005691215.1 | alanine racemase | - |
EL156_RS13085 | 2601515..2601889 | - | 375 | WP_005686634.1 | holo-ACP synthase | - |
EL156_RS13090 | 2602058..2603566 | - | 1509 | WP_005686635.1 | DEAD/DEAH box helicase | - |
EL156_RS13095 | 2603840..2605228 | - | 1389 | WP_014571607.1 | UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13757.03 Da Isoelectric Point: 10.9764
>T287678 WP_005686631.1 NZ_LR134322:c2600009-2599626 [Lacticaseibacillus rhamnosus]
MDVTVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSAKMAAVDRALAISVGLVSLPKPKTYNKN
MDVTVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSAKMAAVDRALAISVGLVSLPKPKTYNKN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|