Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 2502718..2503280 | Replicon | chromosome |
| Accession | NZ_LR134322 | ||
| Organism | Lacticaseibacillus rhamnosus strain NCTC13710 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | C2JYM4 |
| Locus tag | EL156_RS12560 | Protein ID | WP_005692155.1 |
| Coordinates | 2502718..2503065 (-) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | EL156_RS12565 | Protein ID | WP_014571589.1 |
| Coordinates | 2503065..2503280 (-) | Length | 72 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL156_RS12525 | 2498213..2499454 | - | 1242 | WP_005692160.1 | acyltransferase | - |
| EL156_RS12530 | 2499451..2500152 | - | 702 | WP_005692159.1 | ABC transporter ATP-binding protein | - |
| EL156_RS12535 | 2500145..2500963 | - | 819 | WP_014571588.1 | ABC transporter permease subunit | - |
| EL156_RS12540 | 2501204..2501872 | - | 669 | WP_005692157.1 | tRNA ligase | - |
| EL156_RS12550 | 2502052..2502195 | + | 144 | WP_020752296.1 | hypothetical protein | - |
| EL156_RS12560 | 2502718..2503065 | - | 348 | WP_005692155.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EL156_RS12565 | 2503065..2503280 | - | 216 | WP_014571589.1 | hypothetical protein | Antitoxin |
| EL156_RS12570 | 2503377..2505212 | - | 1836 | WP_015764721.1 | ABC transporter ATP-binding protein/permease | - |
| EL156_RS12575 | 2505199..2506989 | - | 1791 | WP_015764722.1 | ABC transporter ATP-binding protein/permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13150.01 Da Isoelectric Point: 7.9817
>T287677 WP_005692155.1 NZ_LR134322:c2503065-2502718 [Lacticaseibacillus rhamnosus]
MTYKAKQGDVVWLDFDPSEGHEIRKRCPAVVLSSNAYNRATGFVIVAPITSTIRTLPGYVDIVSNKIRGQVVTSQVYSLD
VTEQGNRKIDFIERMNIEDFYTVAQFTKMNFDFKF
MTYKAKQGDVVWLDFDPSEGHEIRKRCPAVVLSSNAYNRATGFVIVAPITSTIRTLPGYVDIVSNKIRGQVVTSQVYSLD
VTEQGNRKIDFIERMNIEDFYTVAQFTKMNFDFKF
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|