Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ygfYX/Cpta(toxin) |
Location | 3552816..3553485 | Replicon | chromosome |
Accession | NZ_LR134321 | ||
Organism | Shewanella baltica strain NCTC10737 |
Toxin (Protein)
Gene name | ygfX | Uniprot ID | - |
Locus tag | EL185_RS15430 | Protein ID | WP_126492495.1 |
Coordinates | 3552816..3553256 (-) | Length | 147 a.a. |
Antitoxin (Protein)
Gene name | ygfY | Uniprot ID | - |
Locus tag | EL185_RS15435 | Protein ID | WP_126492496.1 |
Coordinates | 3553237..3553485 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL185_RS15405 | 3548285..3548758 | - | 474 | WP_006080776.1 | SoxR reducing system RseC family protein | - |
EL185_RS15410 | 3548769..3549701 | - | 933 | WP_006080775.1 | MucB/RseB C-terminal domain-containing protein | - |
EL185_RS15415 | 3549717..3550340 | - | 624 | WP_126492493.1 | anti-sigma factor | - |
EL185_RS15420 | 3550382..3550960 | - | 579 | WP_006080773.1 | RNA polymerase sigma factor RpoE | - |
EL185_RS15425 | 3551150..3552763 | + | 1614 | WP_126492494.1 | L-aspartate oxidase | - |
EL185_RS15430 | 3552816..3553256 | - | 441 | WP_126492495.1 | hypothetical protein | Toxin |
EL185_RS15435 | 3553237..3553485 | - | 249 | WP_126492496.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
EL185_RS15440 | 3553571..3554479 | - | 909 | WP_063884532.1 | transcriptional activator NhaR | - |
EL185_RS15445 | 3554552..3554938 | - | 387 | WP_126492497.1 | hypothetical protein | - |
EL185_RS15450 | 3554941..3556110 | - | 1170 | WP_006080767.1 | Na+/H+ antiporter NhaA | - |
EL185_RS15455 | 3556228..3557022 | - | 795 | WP_006080766.1 | thymidylate synthase | - |
EL185_RS15460 | 3557019..3557828 | - | 810 | WP_126492498.1 | prolipoprotein diacylglyceryl transferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 147 a.a. Molecular weight: 17374.43 Da Isoelectric Point: 7.7168
>T287675 WP_126492495.1 NZ_LR134321:c3553256-3552816 [Shewanella baltica]
VEDRHHSFSVKASFDQRLSLVVFICVCSSSFLLWPQSDNLTLSLLKYMFILLVCIFLLSQLWRLQHWRLDFVLSDKGEGR
LSTGEHFQVLRRTWVTPFVCLMYIEVDTQLRLLMVWADMLDDTDYRHLCRLLLRAKIQQTKPHTEI
VEDRHHSFSVKASFDQRLSLVVFICVCSSSFLLWPQSDNLTLSLLKYMFILLVCIFLLSQLWRLQHWRLDFVLSDKGEGR
LSTGEHFQVLRRTWVTPFVCLMYIEVDTQLRLLMVWADMLDDTDYRHLCRLLLRAKIQQTKPHTEI
Download Length: 441 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|