Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ParE-CopA/ParE-RHH |
Location | 2778642..2779207 | Replicon | chromosome |
Accession | NZ_LR134321 | ||
Organism | Shewanella baltica strain NCTC10737 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | EL185_RS11970 | Protein ID | WP_107947282.1 |
Coordinates | 2778914..2779207 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | copA | Uniprot ID | A0A448EM94 |
Locus tag | EL185_RS11965 | Protein ID | WP_011716807.1 |
Coordinates | 2778642..2778926 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL185_RS11925 | 2773901..2774092 | - | 192 | WP_126493497.1 | AlpA family transcriptional regulator | - |
EL185_RS11930 | 2774242..2774733 | + | 492 | WP_197721157.1 | DNA repair protein RadC | - |
EL185_RS11935 | 2774774..2775136 | + | 363 | WP_126492066.1 | hypothetical protein | - |
EL185_RS11940 | 2775267..2775623 | + | 357 | WP_126492067.1 | type IV toxin-antitoxin system YeeU family antitoxin | - |
EL185_RS11945 | 2775868..2776281 | + | 414 | WP_126492068.1 | DUF2787 domain-containing protein | - |
EL185_RS11950 | 2776472..2776879 | + | 408 | WP_126492069.1 | DUF2787 domain-containing protein | - |
EL185_RS11955 | 2776988..2777554 | + | 567 | WP_126492070.1 | site-specific integrase | - |
EL185_RS11960 | 2777633..2778355 | + | 723 | WP_126492071.1 | lecithin retinol acyltransferase family protein | - |
EL185_RS11965 | 2778642..2778926 | + | 285 | WP_011716807.1 | CopG family ribbon-helix-helix protein | Antitoxin |
EL185_RS11970 | 2778914..2779207 | + | 294 | WP_107947282.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL185_RS11975 | 2779379..2780041 | - | 663 | WP_126492072.1 | inovirus Gp2 family protein | - |
EL185_RS11980 | 2780377..2781840 | - | 1464 | WP_126492073.1 | DUF3987 domain-containing protein | - |
EL185_RS11985 | 2781878..2782090 | - | 213 | WP_126492074.1 | AlpA family phage regulatory protein | - |
EL185_RS11990 | 2782209..2783285 | - | 1077 | WP_126492075.1 | cytoplasmic protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11152.68 Da Isoelectric Point: 5.8404
>T287674 WP_107947282.1 NZ_LR134321:2778914-2779207 [Shewanella baltica]
MPQIIFTATALRDLERLREFLRSKNPPAAQRAASAIINTIRKLESYPDIGRPIDDNDFNFRELLIDFGDTGYLAMYQYDG
GERLTVLCVRHQKEAGY
MPQIIFTATALRDLERLREFLRSKNPPAAQRAASAIINTIRKLESYPDIGRPIDDNDFNFRELLIDFGDTGYLAMYQYDG
GERLTVLCVRHQKEAGY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|