Detailed information of TA system
Overview
TA module
| Type | VII | Classification (family/domain) | HepT-MntA/HepT(toxin) |
| Location | 1661674..1662505 | Replicon | chromosome |
| Accession | NZ_LR134321 | ||
| Organism | Shewanella baltica strain NCTC10737 | ||
Toxin (Protein)
| Gene name | hepT | Uniprot ID | - |
| Locus tag | EL185_RS07210 | Protein ID | WP_088585313.1 |
| Coordinates | 1661674..1662090 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | mntA | Uniprot ID | - |
| Locus tag | EL185_RS07215 | Protein ID | WP_126491558.1 |
| Coordinates | 1662083..1662505 (-) | Length | 141 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL185_RS07175 | 1657865..1659160 | + | 1296 | WP_126491573.1 | tandem-95 repeat protein | - |
| EL185_RS07180 | 1659279..1659398 | + | 120 | WP_126491574.1 | type II toxin-antitoxin system YoeB family toxin | - |
| EL185_RS07185 | 1659445..1659597 | - | 153 | WP_126491575.1 | helix-turn-helix transcriptional regulator | - |
| EL185_RS07190 | 1659915..1660367 | - | 453 | WP_126491576.1 | hypothetical protein | - |
| EL185_RS07195 | 1660406..1660885 | - | 480 | WP_197721151.1 | hypothetical protein | - |
| EL185_RS07200 | 1661195..1661278 | + | 84 | WP_126493479.1 | hypothetical protein | - |
| EL185_RS07210 | 1661674..1662090 | - | 417 | WP_088585313.1 | DUF86 domain-containing protein | Toxin |
| EL185_RS07215 | 1662083..1662505 | - | 423 | WP_126491558.1 | nucleotidyltransferase domain-containing protein | Antitoxin |
| EL185_RS07220 | 1662794..1663039 | + | 246 | WP_014610893.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
| EL185_RS07225 | 1663039..1663356 | + | 318 | WP_126491578.1 | CcdB family protein | - |
| EL185_RS07230 | 1663711..1665078 | + | 1368 | WP_014610930.1 | HipA domain-containing protein | - |
| EL185_RS07235 | 1665075..1665455 | + | 381 | WP_086904820.1 | helix-turn-helix domain-containing protein | - |
| EL185_RS07240 | 1665619..1665960 | - | 342 | WP_014610929.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| EL185_RS07245 | 1665957..1666211 | - | 255 | WP_014610888.1 | type II toxin-antitoxin system HicA family toxin | - |
| EL185_RS07250 | 1666611..1667222 | - | 612 | WP_126491579.1 | mobile mystery protein B | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 16056.55 Da Isoelectric Point: 7.3244
>T287671 WP_088585313.1 NZ_LR134321:c1662090-1661674 [Shewanella baltica]
MNDIIINKIATIKRCIKRIQQVYGDGSMFKQDFTLQDSVILNLQRCCEASIDIANHINRQQQLGIPQSSRDSFTLLSQNK
IINQQLADNLKKMVGLRNIAVHDYQELNLDIVVHVVQHHLEDFEQFIEVIKFCPRMSY
MNDIIINKIATIKRCIKRIQQVYGDGSMFKQDFTLQDSVILNLQRCCEASIDIANHINRQQQLGIPQSSRDSFTLLSQNK
IINQQLADNLKKMVGLRNIAVHDYQELNLDIVVHVVQHHLEDFEQFIEVIKFCPRMSY
Download Length: 417 bp
Antitoxin
Download Length: 141 a.a. Molecular weight: 15859.91 Da Isoelectric Point: 5.1231
>AT287671 WP_126491558.1 NZ_LR134321:c1662505-1662083 [Shewanella baltica]
MQQLNESIIINLLQDNIPQLRLIYLFGSYAQGTQHRNSDIDIAVLADVTVDNIARWQLAQKLASALDTDVDLVDLRTAST
VLCQQVVTQGKRLWGTRQDDEIFAVKTISMYQHLQAERQAIIDDATAKTIANDHRGRHFE
MQQLNESIIINLLQDNIPQLRLIYLFGSYAQGTQHRNSDIDIAVLADVTVDNIARWQLAQKLASALDTDVDLVDLRTAST
VLCQQVVTQGKRLWGTRQDDEIFAVKTISMYQHLQAERQAIIDDATAKTIANDHRGRHFE
Download Length: 423 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|