Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1648697..1649283 | Replicon | chromosome |
| Accession | NZ_LR134320 | ||
| Organism | Streptococcus mutans strain NCTC10832 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | EL130_RS08325 | Protein ID | WP_002265423.1 |
| Coordinates | 1649092..1649283 (-) | Length | 64 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A0H5AQZ7 |
| Locus tag | EL130_RS08320 | Protein ID | WP_002269450.1 |
| Coordinates | 1648697..1649074 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL130_RS08310 | 1645479..1645763 | - | 285 | WP_002278032.1 | helix-turn-helix transcriptional regulator | - |
| EL130_RS08315 | 1646079..1646972 | + | 894 | WP_002272311.1 | LexA family transcriptional regulator IrvR | - |
| EL130_RS08320 | 1648697..1649074 | - | 378 | WP_002269450.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| EL130_RS08325 | 1649092..1649283 | - | 192 | WP_002265423.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| EL130_RS08330 | 1649380..1650042 | - | 663 | WP_002263546.1 | type II-A CRISPR-associated protein Csn2 | - |
| EL130_RS08335 | 1650032..1650376 | - | 345 | WP_002264918.1 | CRISPR-associated endonuclease Cas2 | - |
| EL130_RS08340 | 1650373..1651239 | - | 867 | WP_002264919.1 | type II CRISPR-associated endonuclease Cas1 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 64 a.a. Molecular weight: 7177.52 Da Isoelectric Point: 10.7089
>T287666 WP_002265423.1 NZ_LR134320:c1649283-1649092 [Streptococcus mutans]
MPLTGKELARLAINNGWEEVRVRGSHHHFKKDGVPYIVTIPIHGNKVLKIGLEKKLLRDLNLL
MPLTGKELARLAINNGWEEVRVRGSHHHFKKDGVPYIVTIPIHGNKVLKIGLEKKLLRDLNLL
Download Length: 192 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 14293.28 Da Isoelectric Point: 4.5628
>AT287666 WP_002269450.1 NZ_LR134320:c1649074-1648697 [Streptococcus mutans]
MLKSYPAIFHKEEEGYWVEFPEFGGGTQGEDLEEAMKNARQMLESVLASYLDEGMKLPNPSEIRKLSVEDGFATMIQADP
NPYLKNNKAIRKNVTVPEWLVQLADRDQVNYSEVLTKALEKKLQL
MLKSYPAIFHKEEEGYWVEFPEFGGGTQGEDLEEAMKNARQMLESVLASYLDEGMKLPNPSEIRKLSVEDGFATMIQADP
NPYLKNNKAIRKNVTVPEWLVQLADRDQVNYSEVLTKALEKKLQL
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|