Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 207812..208383 | Replicon | chromosome |
Accession | NZ_LR134320 | ||
Organism | Streptococcus mutans strain NCTC10832 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A2J9QC66 |
Locus tag | EL130_RS01090 | Protein ID | WP_002265705.1 |
Coordinates | 207812..208144 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | EL130_RS01095 | Protein ID | WP_002283816.1 |
Coordinates | 208138..208383 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL130_RS01065 | 203331..203933 | - | 603 | WP_002274543.1 | NAD(P)H-dependent oxidoreductase | - |
EL130_RS01070 | 204075..204923 | - | 849 | WP_002267691.1 | alpha/beta hydrolase | - |
EL130_RS01075 | 204901..206121 | - | 1221 | WP_002270688.1 | PTS sugar transporter subunit IIC | - |
EL130_RS10140 | 206300..206656 | - | 357 | Protein_195 | transposase family protein | - |
EL130_RS01085 | 206823..207614 | + | 792 | WP_025985792.1 | DUF4037 domain-containing protein | - |
EL130_RS01090 | 207812..208144 | - | 333 | WP_002265705.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL130_RS01095 | 208138..208383 | - | 246 | WP_002283816.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
EL130_RS01100 | 208705..209097 | - | 393 | WP_002262992.1 | 30S ribosomal protein S9 | - |
EL130_RS01105 | 209122..209568 | - | 447 | WP_002262993.1 | 50S ribosomal protein L13 | - |
EL130_RS01115 | 209961..210155 | - | 195 | WP_002262994.1 | helix-turn-helix transcriptional regulator | - |
EL130_RS01120 | 210152..210598 | - | 447 | WP_002264865.1 | hypothetical protein | - |
EL130_RS01125 | 210598..211113 | - | 516 | WP_002281462.1 | hypothetical protein | - |
EL130_RS01130 | 211245..212105 | - | 861 | WP_002283815.1 | DegV family protein | - |
EL130_RS01135 | 212129..212875 | - | 747 | WP_002283814.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 206528..206656 | 128 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12664.56 Da Isoelectric Point: 6.4634
>T287664 WP_002265705.1 NZ_LR134320:c208144-207812 [Streptococcus mutans]
MVTIKQGSIIKINLDPKQGHEQKGYRPYICLNHSIVTKYSNIAIFAPISNTKRDYPFYVPLEGTESTGKVLLDQLVTIDF
NARDYRYVEDIQEDLLDELLARVKVLFEKG
MVTIKQGSIIKINLDPKQGHEQKGYRPYICLNHSIVTKYSNIAIFAPISNTKRDYPFYVPLEGTESTGKVLLDQLVTIDF
NARDYRYVEDIQEDLLDELLARVKVLFEKG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|