Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1722897..1723513 | Replicon | chromosome |
Accession | NZ_LR134318 | ||
Organism | Pseudomonas fluorescens strain NCTC9428 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | EL257_RS07910 | Protein ID | WP_126361315.1 |
Coordinates | 1722897..1723109 (+) | Length | 71 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | EL257_RS07915 | Protein ID | WP_126361317.1 |
Coordinates | 1723109..1723513 (+) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL257_RS07885 | 1718013..1720001 | + | 1989 | WP_126361307.1 | heme lyase CcmF/NrfE family subunit | - |
EL257_RS07890 | 1719998..1720534 | + | 537 | WP_126361309.1 | DsbE family thiol:disulfide interchange protein | - |
EL257_RS07895 | 1720531..1721001 | + | 471 | WP_126361311.1 | cytochrome c-type biogenesis protein CcmH | - |
EL257_RS07900 | 1720998..1722200 | + | 1203 | WP_126361313.1 | c-type cytochrome biogenesis protein CcmI | - |
EL257_RS07905 | 1722226..1722630 | + | 405 | WP_073472737.1 | hypothetical protein | - |
EL257_RS07910 | 1722897..1723109 | + | 213 | WP_126361315.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
EL257_RS07915 | 1723109..1723513 | + | 405 | WP_126361317.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
EL257_RS07920 | 1723585..1724784 | - | 1200 | WP_126361319.1 | MFS transporter | - |
EL257_RS07925 | 1724951..1725949 | - | 999 | WP_126361321.1 | sulfate ABC transporter substrate-binding protein | - |
EL257_RS07930 | 1726197..1727021 | - | 825 | WP_126361323.1 | ion transporter | - |
EL257_RS07935 | 1727043..1727957 | - | 915 | WP_126361326.1 | urea transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7878.05 Da Isoelectric Point: 10.7251
>T287660 WP_126361315.1 NZ_LR134318:1722897-1723109 [Pseudomonas fluorescens]
VQSRLLIKELEAAGWTLDRVTGSHHIFKHRYNPHTIPVPHPKKDLPLGTVKSIRRRAGLHNPPAGYEGDP
VQSRLLIKELEAAGWTLDRVTGSHHIFKHRYNPHTIPVPHPKKDLPLGTVKSIRRRAGLHNPPAGYEGDP
Download Length: 213 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14832.78 Da Isoelectric Point: 4.2870
>AT287660 WP_126361317.1 NZ_LR134318:1723109-1723513 [Pseudomonas fluorescens]
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDSFEDAYNAAVEIAHIMLQEIAADGESIPMPTSASAHRNNLEFADMGWGM
LDLDISPYLGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRY
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDSFEDAYNAAVEIAHIMLQEIAADGESIPMPTSASAHRNNLEFADMGWGM
LDLDISPYLGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRY
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|