Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3976373..3977208 | Replicon | chromosome |
| Accession | NZ_LR134315 | ||
| Organism | Escherichia coli strain NCTC9064 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A2S4A272 |
| Locus tag | EL184_RS19375 | Protein ID | WP_001094443.1 |
| Coordinates | 3976373..3976750 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7LDN9 |
| Locus tag | EL184_RS19380 | Protein ID | WP_001285607.1 |
| Coordinates | 3976840..3977208 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL184_RS19345 | 3972563..3973759 | - | 1197 | Protein_3747 | IS3 family transposase | - |
| EL184_RS19350 | 3973793..3974978 | - | 1186 | Protein_3748 | integrase arm-type DNA-binding domain-containing protein | - |
| EL184_RS22675 | 3975440..3975586 | - | 147 | WP_001290178.1 | hypothetical protein | - |
| EL184_RS19365 | 3975671..3975868 | - | 198 | WP_001327226.1 | DUF957 domain-containing protein | - |
| EL184_RS19370 | 3975888..3976376 | - | 489 | WP_000761685.1 | hypothetical protein | - |
| EL184_RS19375 | 3976373..3976750 | - | 378 | WP_001094443.1 | TA system toxin CbtA family protein | Toxin |
| EL184_RS19380 | 3976840..3977208 | - | 369 | WP_001285607.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL184_RS19385 | 3977288..3977509 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| EL184_RS19390 | 3977596..3978072 | - | 477 | WP_001186165.1 | RadC family protein | - |
| EL184_RS19395 | 3978087..3978572 | - | 486 | WP_000206664.1 | antirestriction protein | - |
| EL184_RS19400 | 3978664..3979482 | - | 819 | WP_001175163.1 | DUF945 domain-containing protein | - |
| EL184_RS19405 | 3979572..3979805 | - | 234 | WP_001278287.1 | DUF905 family protein | - |
| EL184_RS19410 | 3979811..3980488 | - | 678 | WP_001097301.1 | hypothetical protein | - |
| EL184_RS19415 | 3980636..3981316 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3962491..4011880 | 49389 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14058.97 Da Isoelectric Point: 7.3523
>T287654 WP_001094443.1 NZ_LR134315:c3976750-3976373 [Escherichia coli]
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13689.53 Da Isoelectric Point: 6.4669
>AT287654 WP_001285607.1 NZ_LR134315:c3977208-3976840 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S4A272 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M0JLU8 |