Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2358924..2359562 | Replicon | chromosome |
Accession | NZ_LR134315 | ||
Organism | Escherichia coli strain NCTC9064 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | EL184_RS11525 | Protein ID | WP_000813794.1 |
Coordinates | 2359386..2359562 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | EL184_RS11520 | Protein ID | WP_001270286.1 |
Coordinates | 2358924..2359340 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL184_RS11500 | 2354076..2355017 | - | 942 | WP_096835667.1 | ABC transporter permease | - |
EL184_RS11505 | 2355018..2356031 | - | 1014 | WP_096835666.1 | ABC transporter ATP-binding protein | - |
EL184_RS11510 | 2356049..2357194 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
EL184_RS11515 | 2357439..2358845 | - | 1407 | WP_000760614.1 | PLP-dependent aminotransferase family protein | - |
EL184_RS11520 | 2358924..2359340 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
EL184_RS11525 | 2359386..2359562 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
EL184_RS11530 | 2359784..2360014 | + | 231 | WP_000494244.1 | YncJ family protein | - |
EL184_RS11535 | 2360106..2362067 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
EL184_RS11540 | 2362140..2362676 | - | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
EL184_RS11545 | 2362729..2363943 | + | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2363983..2365131 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T287649 WP_000813794.1 NZ_LR134315:c2359562-2359386 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT287649 WP_001270286.1 NZ_LR134315:c2359340-2358924 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|